go.mod: github.com/minio/sha256-simd v1.0.1
https://github.com/minio/sha256-simd/compare/v1.0.0...v1.0.1 Signed-off-by: Akihiro Suda <akihiro.suda.cz@hco.ntt.co.jp>
This commit is contained in:
74
vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml
generated
vendored
Normal file
74
vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml
generated
vendored
Normal file
@@ -0,0 +1,74 @@
|
||||
# This is an example goreleaser.yaml file with some sane defaults.
|
||||
# Make sure to check the documentation at http://goreleaser.com
|
||||
|
||||
builds:
|
||||
-
|
||||
id: "cpuid"
|
||||
binary: cpuid
|
||||
main: ./cmd/cpuid/main.go
|
||||
env:
|
||||
- CGO_ENABLED=0
|
||||
flags:
|
||||
- -ldflags=-s -w
|
||||
goos:
|
||||
- aix
|
||||
- linux
|
||||
- freebsd
|
||||
- netbsd
|
||||
- windows
|
||||
- darwin
|
||||
goarch:
|
||||
- 386
|
||||
- amd64
|
||||
- arm64
|
||||
goarm:
|
||||
- 7
|
||||
|
||||
archives:
|
||||
-
|
||||
id: cpuid
|
||||
name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}"
|
||||
replacements:
|
||||
aix: AIX
|
||||
darwin: OSX
|
||||
linux: Linux
|
||||
windows: Windows
|
||||
386: i386
|
||||
amd64: x86_64
|
||||
freebsd: FreeBSD
|
||||
netbsd: NetBSD
|
||||
format_overrides:
|
||||
- goos: windows
|
||||
format: zip
|
||||
files:
|
||||
- LICENSE
|
||||
checksum:
|
||||
name_template: 'checksums.txt'
|
||||
snapshot:
|
||||
name_template: "{{ .Tag }}-next"
|
||||
changelog:
|
||||
sort: asc
|
||||
filters:
|
||||
exclude:
|
||||
- '^doc:'
|
||||
- '^docs:'
|
||||
- '^test:'
|
||||
- '^tests:'
|
||||
- '^Update\sREADME.md'
|
||||
|
||||
nfpms:
|
||||
-
|
||||
file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}"
|
||||
vendor: Klaus Post
|
||||
homepage: https://github.com/klauspost/cpuid
|
||||
maintainer: Klaus Post <klauspost@gmail.com>
|
||||
description: CPUID Tool
|
||||
license: BSD 3-Clause
|
||||
formats:
|
||||
- deb
|
||||
- rpm
|
||||
replacements:
|
||||
darwin: Darwin
|
||||
linux: Linux
|
||||
freebsd: FreeBSD
|
||||
amd64: x86_64
|
||||
56
vendor/github.com/klauspost/cpuid/v2/.travis.yml
generated
vendored
56
vendor/github.com/klauspost/cpuid/v2/.travis.yml
generated
vendored
@@ -1,56 +0,0 @@
|
||||
language: go
|
||||
|
||||
os:
|
||||
- linux
|
||||
- osx
|
||||
- windows
|
||||
|
||||
arch:
|
||||
- amd64
|
||||
- arm64
|
||||
|
||||
go:
|
||||
- 1.13.x
|
||||
- 1.14.x
|
||||
- 1.15.x
|
||||
- 1.16.x
|
||||
- master
|
||||
|
||||
script:
|
||||
- go vet ./...
|
||||
- go test -test.v -test.run ^TestCPUID$
|
||||
- go test -race ./...
|
||||
- go test -tags=noasm ./...
|
||||
|
||||
matrix:
|
||||
allow_failures:
|
||||
- go: 'master'
|
||||
fast_finish: true
|
||||
include:
|
||||
- stage: gofmt
|
||||
go: 1.15.x
|
||||
os: linux
|
||||
arch: amd64
|
||||
script:
|
||||
- diff <(gofmt -d .) <(printf "")
|
||||
- diff <(gofmt -d ./private) <(printf "")
|
||||
- go install github.com/klauspost/asmfmt/cmd/asmfmt
|
||||
- diff <(asmfmt -d .) <(printf "")
|
||||
- stage: i386
|
||||
go: 1.15.x
|
||||
os: linux
|
||||
arch: amd64
|
||||
script:
|
||||
- GOOS=linux GOARCH=386 go test .
|
||||
- stage: buildotherprev
|
||||
go: 1.15.x
|
||||
os: linux
|
||||
arch: amd64
|
||||
script:
|
||||
- ./test-architectures.sh
|
||||
- stage: buildother
|
||||
go: 1.16.x
|
||||
os: linux
|
||||
arch: amd64
|
||||
script:
|
||||
- ./test-architectures.sh
|
||||
366
vendor/github.com/klauspost/cpuid/v2/README.md
generated
vendored
366
vendor/github.com/klauspost/cpuid/v2/README.md
generated
vendored
@@ -16,10 +16,23 @@ Package home: https://github.com/klauspost/cpuid
|
||||
|
||||
## installing
|
||||
|
||||
`go get -u github.com/klauspost/cpuid/v2` using modules.
|
||||
|
||||
`go get -u github.com/klauspost/cpuid/v2` using modules.
|
||||
Drop `v2` for others.
|
||||
|
||||
Installing binary:
|
||||
|
||||
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
|
||||
|
||||
Or download binaries from release page: https://github.com/klauspost/cpuid/releases
|
||||
|
||||
### Homebrew
|
||||
|
||||
For macOS/Linux users, you can install via [brew](https://brew.sh/)
|
||||
|
||||
```sh
|
||||
$ brew install cpuid
|
||||
```
|
||||
|
||||
## example
|
||||
|
||||
```Go
|
||||
@@ -39,10 +52,10 @@ func main() {
|
||||
fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore)
|
||||
fmt.Println("LogicalCores:", CPU.LogicalCores)
|
||||
fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID)
|
||||
fmt.Println("Features:", fmt.Sprintf(strings.Join(CPU.FeatureSet(), ",")))
|
||||
fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ","))
|
||||
fmt.Println("Cacheline bytes:", CPU.CacheLine)
|
||||
fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes")
|
||||
fmt.Println("L1 Instruction Cache:", CPU.Cache.L1D, "bytes")
|
||||
fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes")
|
||||
fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes")
|
||||
fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes")
|
||||
fmt.Println("Frequency", CPU.Hz, "hz")
|
||||
@@ -77,10 +90,14 @@ We have Streaming SIMD 2 Extensions
|
||||
The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
|
||||
A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.
|
||||
|
||||
To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
|
||||
This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
|
||||
|
||||
Note that for some cpu/os combinations some features will not be detected.
|
||||
`amd64` has rather good support and should work reliably on all platforms.
|
||||
|
||||
Note that hypervisors may not pass through all CPU features.
|
||||
Note that hypervisors may not pass through all CPU features through to the guest OS,
|
||||
so even if your host supports a feature it may not be visible on guests.
|
||||
|
||||
## arm64 feature detection
|
||||
|
||||
@@ -132,6 +149,345 @@ func main() {
|
||||
}
|
||||
```
|
||||
|
||||
## commandline
|
||||
|
||||
Download as binary from: https://github.com/klauspost/cpuid/releases
|
||||
|
||||
Install from source:
|
||||
|
||||
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
|
||||
|
||||
### Example
|
||||
|
||||
```
|
||||
λ cpuid
|
||||
Name: AMD Ryzen 9 3950X 16-Core Processor
|
||||
Vendor String: AuthenticAMD
|
||||
Vendor ID: AMD
|
||||
PhysicalCores: 16
|
||||
Threads Per Core: 2
|
||||
Logical Cores: 32
|
||||
CPU Family 23 Model: 113
|
||||
Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE
|
||||
Microarchitecture level: 3
|
||||
Cacheline bytes: 64
|
||||
L1 Instruction Cache: 32768 bytes
|
||||
L1 Data Cache: 32768 bytes
|
||||
L2 Cache: 524288 bytes
|
||||
L3 Cache: 16777216 bytes
|
||||
|
||||
```
|
||||
### JSON Output:
|
||||
|
||||
```
|
||||
λ cpuid --json
|
||||
{
|
||||
"BrandName": "AMD Ryzen 9 3950X 16-Core Processor",
|
||||
"VendorID": 2,
|
||||
"VendorString": "AuthenticAMD",
|
||||
"PhysicalCores": 16,
|
||||
"ThreadsPerCore": 2,
|
||||
"LogicalCores": 32,
|
||||
"Family": 23,
|
||||
"Model": 113,
|
||||
"CacheLine": 64,
|
||||
"Hz": 0,
|
||||
"BoostFreq": 0,
|
||||
"Cache": {
|
||||
"L1I": 32768,
|
||||
"L1D": 32768,
|
||||
"L2": 524288,
|
||||
"L3": 16777216
|
||||
},
|
||||
"SGX": {
|
||||
"Available": false,
|
||||
"LaunchControl": false,
|
||||
"SGX1Supported": false,
|
||||
"SGX2Supported": false,
|
||||
"MaxEnclaveSizeNot64": 0,
|
||||
"MaxEnclaveSize64": 0,
|
||||
"EPCSections": null
|
||||
},
|
||||
"Features": [
|
||||
"ADX",
|
||||
"AESNI",
|
||||
"AVX",
|
||||
"AVX2",
|
||||
"BMI1",
|
||||
"BMI2",
|
||||
"CLMUL",
|
||||
"CLZERO",
|
||||
"CMOV",
|
||||
"CMPXCHG8",
|
||||
"CPBOOST",
|
||||
"CX16",
|
||||
"F16C",
|
||||
"FMA3",
|
||||
"FXSR",
|
||||
"FXSROPT",
|
||||
"HTT",
|
||||
"HYPERVISOR",
|
||||
"LAHF",
|
||||
"LZCNT",
|
||||
"MCAOVERFLOW",
|
||||
"MMX",
|
||||
"MMXEXT",
|
||||
"MOVBE",
|
||||
"NX",
|
||||
"OSXSAVE",
|
||||
"POPCNT",
|
||||
"RDRAND",
|
||||
"RDSEED",
|
||||
"RDTSCP",
|
||||
"SCE",
|
||||
"SHA",
|
||||
"SSE",
|
||||
"SSE2",
|
||||
"SSE3",
|
||||
"SSE4",
|
||||
"SSE42",
|
||||
"SSE4A",
|
||||
"SSSE3",
|
||||
"SUCCOR",
|
||||
"X87",
|
||||
"XSAVE"
|
||||
],
|
||||
"X64Level": 3
|
||||
}
|
||||
```
|
||||
|
||||
### Check CPU microarch level
|
||||
|
||||
```
|
||||
λ cpuid --check-level=3
|
||||
2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor
|
||||
2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3.
|
||||
Exit Code 0
|
||||
|
||||
λ cpuid --check-level=4
|
||||
2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor
|
||||
2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3.
|
||||
Exit Code 1
|
||||
```
|
||||
|
||||
|
||||
## Available flags
|
||||
|
||||
### x86 & amd64
|
||||
|
||||
| Feature Flag | Description |
|
||||
|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
|
||||
| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) |
|
||||
| AESNI | Advanced Encryption Standard New Instructions |
|
||||
| AMD3DNOW | AMD 3DNOW |
|
||||
| AMD3DNOWEXT | AMD 3DNowExt |
|
||||
| AMXBF16 | Tile computational operations on BFLOAT16 numbers |
|
||||
| AMXINT8 | Tile computational operations on 8-bit integers |
|
||||
| AMXFP16 | Tile computational operations on FP16 numbers |
|
||||
| AMXTILE | Tile architecture |
|
||||
| AVX | AVX functions |
|
||||
| AVX2 | AVX2 functions |
|
||||
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
|
||||
| AVX512BITALG | AVX-512 Bit Algorithms |
|
||||
| AVX512BW | AVX-512 Byte and Word Instructions |
|
||||
| AVX512CD | AVX-512 Conflict Detection Instructions |
|
||||
| AVX512DQ | AVX-512 Doubleword and Quadword Instructions |
|
||||
| AVX512ER | AVX-512 Exponential and Reciprocal Instructions |
|
||||
| AVX512F | AVX-512 Foundation |
|
||||
| AVX512FP16 | AVX-512 FP16 Instructions |
|
||||
| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions |
|
||||
| AVX512PF | AVX-512 Prefetch Instructions |
|
||||
| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions |
|
||||
| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 |
|
||||
| AVX512VL | AVX-512 Vector Length Extensions |
|
||||
| AVX512VNNI | AVX-512 Vector Neural Network Instructions |
|
||||
| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q |
|
||||
| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword |
|
||||
| AVXIFMA | AVX-IFMA instructions |
|
||||
| AVXNECONVERT | AVX-NE-CONVERT instructions |
|
||||
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
|
||||
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
|
||||
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
|
||||
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
|
||||
| BMI1 | Bit Manipulation Instruction Set 1 |
|
||||
| BMI2 | Bit Manipulation Instruction Set 2 |
|
||||
| CETIBT | Intel CET Indirect Branch Tracking |
|
||||
| CETSS | Intel CET Shadow Stack |
|
||||
| CLDEMOTE | Cache Line Demote |
|
||||
| CLMUL | Carry-less Multiplication |
|
||||
| CLZERO | CLZERO instruction supported |
|
||||
| CMOV | i686 CMOV |
|
||||
| CMPCCXADD | CMPCCXADD instructions |
|
||||
| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB |
|
||||
| CMPXCHG8 | CMPXCHG8 instruction |
|
||||
| CPBOOST | Core Performance Boost |
|
||||
| CPPC | AMD: Collaborative Processor Performance Control |
|
||||
| CX16 | CMPXCHG16B Instruction |
|
||||
| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ |
|
||||
| ENQCMD | Enqueue Command |
|
||||
| ERMS | Enhanced REP MOVSB/STOSB |
|
||||
| F16C | Half-precision floating-point conversion |
|
||||
| FLUSH_L1D | Flush L1D cache |
|
||||
| FMA3 | Intel FMA 3. Does not imply AVX. |
|
||||
| FMA4 | Bulldozer FMA4 functions |
|
||||
| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide |
|
||||
| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide |
|
||||
| FSRM | Fast Short Rep Mov |
|
||||
| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 |
|
||||
| FXSROPT | FXSAVE/FXRSTOR optimizations |
|
||||
| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. |
|
||||
| HLE | Hardware Lock Elision |
|
||||
| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR |
|
||||
| HTT | Hyperthreading (enabled) |
|
||||
| HWA | Hardware assert supported. Indicates support for MSRC001_10 |
|
||||
| HYBRID_CPU | This part has CPUs of more than one type. |
|
||||
| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors |
|
||||
| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) |
|
||||
| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR |
|
||||
| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) |
|
||||
| IBRS | AMD: Indirect Branch Restricted Speculation |
|
||||
| IBRS_PREFERRED | AMD: IBRS is preferred over software solution |
|
||||
| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection |
|
||||
| IBS | Instruction Based Sampling (AMD) |
|
||||
| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSFFV | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSOPCNT | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSOPSAM | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) |
|
||||
| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported |
|
||||
| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported |
|
||||
| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
|
||||
| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
|
||||
| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
|
||||
| IDPRED_CTRL | IPRED_DIS |
|
||||
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
|
||||
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
|
||||
| LAHF | LAHF/SAHF in long mode |
|
||||
| LAM | If set, CPU supports Linear Address Masking |
|
||||
| LBRVIRT | LBR virtualization |
|
||||
| LZCNT | LZCNT instruction |
|
||||
| MCAOVERFLOW | MCA overflow recovery support. |
|
||||
| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. |
|
||||
| MCOMMIT | MCOMMIT instruction supported |
|
||||
| MD_CLEAR | VERW clears CPU buffers |
|
||||
| MMX | standard MMX |
|
||||
| MMXEXT | SSE integer functions or AMD MMX ext |
|
||||
| MOVBE | MOVBE instruction (big-endian) |
|
||||
| MOVDIR64B | Move 64 Bytes as Direct Store |
|
||||
| MOVDIRI | Move Doubleword as Direct Store |
|
||||
| MOVSB_ZL | Fast Zero-Length MOVSB |
|
||||
| MPX | Intel MPX (Memory Protection Extensions) |
|
||||
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
|
||||
| MSRIRC | Instruction Retired Counter MSR available |
|
||||
| MSRLIST | Read/Write List of Model Specific Registers |
|
||||
| MSR_PAGEFLUSH | Page Flush MSR available |
|
||||
| NRIPS | Indicates support for NRIP save on VMEXIT |
|
||||
| NX | NX (No-Execute) bit |
|
||||
| OSXSAVE | XSAVE enabled by OS |
|
||||
| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
|
||||
| POPCNT | POPCNT instruction |
|
||||
| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
|
||||
| PREFETCHI | PREFETCHIT0/1 instructions |
|
||||
| PSFD | Predictive Store Forward Disable |
|
||||
| RDPRU | RDPRU instruction supported |
|
||||
| RDRAND | RDRAND instruction is available |
|
||||
| RDSEED | RDSEED instruction is available |
|
||||
| RDTSCP | RDTSCP Instruction |
|
||||
| RRSBA_CTRL | Restricted RSB Alternate |
|
||||
| RTM | Restricted Transactional Memory |
|
||||
| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
|
||||
| SERIALIZE | Serialize Instruction Execution |
|
||||
| SEV | AMD Secure Encrypted Virtualization supported |
|
||||
| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host |
|
||||
| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported |
|
||||
| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests |
|
||||
| SEV_ES | AMD SEV Encrypted State supported |
|
||||
| SEV_RESTRICTED | AMD SEV Restricted Injection supported |
|
||||
| SEV_SNP | AMD SEV Secure Nested Paging supported |
|
||||
| SGX | Software Guard Extensions |
|
||||
| SGXLC | Software Guard Extensions Launch Control |
|
||||
| SHA | Intel SHA Extensions |
|
||||
| SME | AMD Secure Memory Encryption supported |
|
||||
| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced |
|
||||
| SPEC_CTRL_SSBD | Speculative Store Bypass Disable |
|
||||
| SRBDS_CTRL | SRBDS mitigation MSR available |
|
||||
| SSE | SSE functions |
|
||||
| SSE2 | P4 SSE functions |
|
||||
| SSE3 | Prescott SSE3 functions |
|
||||
| SSE4 | Penryn SSE4.1 functions |
|
||||
| SSE42 | Nehalem SSE4.2 functions |
|
||||
| SSE4A | AMD Barcelona microarchitecture SSE4a instructions |
|
||||
| SSSE3 | Conroe SSSE3 functions |
|
||||
| STIBP | Single Thread Indirect Branch Predictors |
|
||||
| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On |
|
||||
| STOSB_SHORT | Fast short STOSB |
|
||||
| SUCCOR | Software uncorrectable error containment and recovery capability. |
|
||||
| SVM | AMD Secure Virtual Machine |
|
||||
| SVMDA | Indicates support for the SVM decode assists. |
|
||||
| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
|
||||
| SVML | AMD SVM lock. Indicates support for SVM-Lock. |
|
||||
| SVMNP | AMD SVM nested paging |
|
||||
| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter |
|
||||
| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold |
|
||||
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
|
||||
| SYSEE | SYSENTER and SYSEXIT instructions |
|
||||
| TBM | AMD Trailing Bit Manipulation |
|
||||
| TDX_GUEST | Intel Trust Domain Extensions Guest |
|
||||
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
|
||||
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
|
||||
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
|
||||
| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 |
|
||||
| TSXLDTRK | Intel TSX Suspend Load Address Tracking |
|
||||
| VAES | Vector AES. AVX(512) versions requires additional checks. |
|
||||
| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. |
|
||||
| VMPL | AMD VM Permission Levels supported |
|
||||
| VMSA_REGPROT | AMD VMSA Register Protection supported |
|
||||
| VMX | Virtual Machine Extensions |
|
||||
| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. |
|
||||
| VTE | AMD Virtual Transparent Encryption supported |
|
||||
| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
|
||||
| WBNOINVD | Write Back and Do Not Invalidate Cache |
|
||||
| WRMSRNS | Non-Serializing Write to Model Specific Register |
|
||||
| X87 | FPU |
|
||||
| XGETBV1 | Supports XGETBV with ECX = 1 |
|
||||
| XOP | Bulldozer XOP functions |
|
||||
| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV |
|
||||
| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. |
|
||||
| XSAVEOPT | XSAVEOPT available |
|
||||
| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS |
|
||||
|
||||
# ARM features:
|
||||
|
||||
| Feature Flag | Description |
|
||||
|--------------|------------------------------------------------------------------|
|
||||
| AESARM | AES instructions |
|
||||
| ARMCPUID | Some CPU ID registers readable at user-level |
|
||||
| ASIMD | Advanced SIMD |
|
||||
| ASIMDDP | SIMD Dot Product |
|
||||
| ASIMDHP | Advanced SIMD half-precision floating point |
|
||||
| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
|
||||
| ATOMICS | Large System Extensions (LSE) |
|
||||
| CRC32 | CRC32/CRC32C instructions |
|
||||
| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
|
||||
| EVTSTRM | Generic timer |
|
||||
| FCMA | Floatin point complex number addition and multiplication |
|
||||
| FP | Single-precision and double-precision floating point |
|
||||
| FPHP | Half-precision floating point |
|
||||
| GPA | Generic Pointer Authentication |
|
||||
| JSCVT | Javascript-style double->int convert (FJCVTZS) |
|
||||
| LRCPC | Weaker release consistency (LDAPR, etc) |
|
||||
| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
|
||||
| SHA1 | SHA-1 instructions (SHA1C, etc) |
|
||||
| SHA2 | SHA-2 instructions (SHA256H, etc) |
|
||||
| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
|
||||
| SHA512 | SHA512 instructions |
|
||||
| SM3 | SM3 instructions |
|
||||
| SM4 | SM4 instructions |
|
||||
| SVE | Scalable Vector Extension |
|
||||
|
||||
# license
|
||||
|
||||
This code is published under an MIT license. See LICENSE file for more information.
|
||||
|
||||
506
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
506
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
@@ -14,7 +14,9 @@ import (
|
||||
"flag"
|
||||
"fmt"
|
||||
"math"
|
||||
"math/bits"
|
||||
"os"
|
||||
"runtime"
|
||||
"strings"
|
||||
)
|
||||
|
||||
@@ -71,6 +73,7 @@ const (
|
||||
AMD3DNOW // AMD 3DNOW
|
||||
AMD3DNOWEXT // AMD 3DNowExt
|
||||
AMXBF16 // Tile computational operations on BFLOAT16 numbers
|
||||
AMXFP16 // Tile computational operations on FP16 numbers
|
||||
AMXINT8 // Tile computational operations on 8-bit integers
|
||||
AMXTILE // Tile architecture
|
||||
AVX // AVX functions
|
||||
@@ -82,6 +85,7 @@ const (
|
||||
AVX512DQ // AVX-512 Doubleword and Quadword Instructions
|
||||
AVX512ER // AVX-512 Exponential and Reciprocal Instructions
|
||||
AVX512F // AVX-512 Foundation
|
||||
AVX512FP16 // AVX-512 FP16 Instructions
|
||||
AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions
|
||||
AVX512PF // AVX-512 Prefetch Instructions
|
||||
AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions
|
||||
@@ -90,23 +94,51 @@ const (
|
||||
AVX512VNNI // AVX-512 Vector Neural Network Instructions
|
||||
AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
|
||||
AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
|
||||
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one.
|
||||
AVXIFMA // AVX-IFMA instructions
|
||||
AVXNECONVERT // AVX-NE-CONVERT instructions
|
||||
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
|
||||
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
|
||||
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
|
||||
BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
|
||||
BMI1 // Bit Manipulation Instruction Set 1
|
||||
BMI2 // Bit Manipulation Instruction Set 2
|
||||
CETIBT // Intel CET Indirect Branch Tracking
|
||||
CETSS // Intel CET Shadow Stack
|
||||
CLDEMOTE // Cache Line Demote
|
||||
CLMUL // Carry-less Multiplication
|
||||
CLZERO // CLZERO instruction supported
|
||||
CMOV // i686 CMOV
|
||||
CMPCCXADD // CMPCCXADD instructions
|
||||
CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
|
||||
CMPXCHG8 // CMPXCHG8 instruction
|
||||
CPBOOST // Core Performance Boost
|
||||
CPPC // AMD: Collaborative Processor Performance Control
|
||||
CX16 // CMPXCHG16B Instruction
|
||||
EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
|
||||
ENQCMD // Enqueue Command
|
||||
ERMS // Enhanced REP MOVSB/STOSB
|
||||
F16C // Half-precision floating-point conversion
|
||||
FLUSH_L1D // Flush L1D cache
|
||||
FMA3 // Intel FMA 3. Does not imply AVX.
|
||||
FMA4 // Bulldozer FMA4 functions
|
||||
GFNI // Galois Field New Instructions
|
||||
FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
|
||||
FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
|
||||
FSRM // Fast Short Rep Mov
|
||||
FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
|
||||
FXSROPT // FXSAVE/FXRSTOR optimizations
|
||||
GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
|
||||
HLE // Hardware Lock Elision
|
||||
HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
|
||||
HTT // Hyperthreading (enabled)
|
||||
HWA // Hardware assert supported. Indicates support for MSRC001_10
|
||||
HYBRID_CPU // This part has CPUs of more than one type.
|
||||
HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors
|
||||
IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
|
||||
IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
|
||||
IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
|
||||
IBRS // AMD: Indirect Branch Restricted Speculation
|
||||
IBRS_PREFERRED // AMD: IBRS is preferred over software solution
|
||||
IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
|
||||
IBS // Instruction Based Sampling (AMD)
|
||||
IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
|
||||
IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
|
||||
@@ -116,22 +148,63 @@ const (
|
||||
IBSOPSAM // Instruction Based Sampling Feature (AMD)
|
||||
IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
|
||||
IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
|
||||
IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
|
||||
IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
|
||||
IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
|
||||
IBS_PREVENTHOST // Disallowing IBS use by the host supported
|
||||
IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
|
||||
IDPRED_CTRL // IPRED_DIS
|
||||
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
|
||||
INVLPGB // NVLPGB and TLBSYNC instruction supported
|
||||
LAHF // LAHF/SAHF in long mode
|
||||
LAM // If set, CPU supports Linear Address Masking
|
||||
LBRVIRT // LBR virtualization
|
||||
LZCNT // LZCNT instruction
|
||||
MCAOVERFLOW // MCA overflow recovery support.
|
||||
MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
|
||||
MCOMMIT // MCOMMIT instruction supported
|
||||
MD_CLEAR // VERW clears CPU buffers
|
||||
MMX // standard MMX
|
||||
MMXEXT // SSE integer functions or AMD MMX ext
|
||||
MOVBE // MOVBE instruction (big-endian)
|
||||
MOVDIR64B // Move 64 Bytes as Direct Store
|
||||
MOVDIRI // Move Doubleword as Direct Store
|
||||
MOVSB_ZL // Fast Zero-Length MOVSB
|
||||
MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
|
||||
MPX // Intel MPX (Memory Protection Extensions)
|
||||
MSRIRC // Instruction Retired Counter MSR available
|
||||
MSRLIST // Read/Write List of Model Specific Registers
|
||||
MSR_PAGEFLUSH // Page Flush MSR available
|
||||
NRIPS // Indicates support for NRIP save on VMEXIT
|
||||
NX // NX (No-Execute) bit
|
||||
OSXSAVE // XSAVE enabled by OS
|
||||
PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
|
||||
POPCNT // POPCNT instruction
|
||||
PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
|
||||
PREFETCHI // PREFETCHIT0/1 instructions
|
||||
PSFD // Predictive Store Forward Disable
|
||||
RDPRU // RDPRU instruction supported
|
||||
RDRAND // RDRAND instruction is available
|
||||
RDSEED // RDSEED instruction is available
|
||||
RDTSCP // RDTSCP Instruction
|
||||
RRSBA_CTRL // Restricted RSB Alternate
|
||||
RTM // Restricted Transactional Memory
|
||||
RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
|
||||
SERIALIZE // Serialize Instruction Execution
|
||||
SEV // AMD Secure Encrypted Virtualization supported
|
||||
SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host
|
||||
SEV_ALTERNATIVE // AMD SEV Alternate Injection supported
|
||||
SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests
|
||||
SEV_ES // AMD SEV Encrypted State supported
|
||||
SEV_RESTRICTED // AMD SEV Restricted Injection supported
|
||||
SEV_SNP // AMD SEV Secure Nested Paging supported
|
||||
SGX // Software Guard Extensions
|
||||
SGXLC // Software Guard Extensions Launch Control
|
||||
SHA // Intel SHA Extensions
|
||||
SME // AMD Secure Memory Encryption supported
|
||||
SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced
|
||||
SPEC_CTRL_SSBD // Speculative Store Bypass Disable
|
||||
SRBDS_CTRL // SRBDS mitigation MSR available
|
||||
SSE // SSE functions
|
||||
SSE2 // P4 SSE functions
|
||||
SSE3 // Prescott SSE3 functions
|
||||
@@ -140,14 +213,42 @@ const (
|
||||
SSE4A // AMD Barcelona microarchitecture SSE4a instructions
|
||||
SSSE3 // Conroe SSSE3 functions
|
||||
STIBP // Single Thread Indirect Branch Predictors
|
||||
STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
|
||||
STOSB_SHORT // Fast short STOSB
|
||||
SUCCOR // Software uncorrectable error containment and recovery capability.
|
||||
SVM // AMD Secure Virtual Machine
|
||||
SVMDA // Indicates support for the SVM decode assists.
|
||||
SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
|
||||
SVML // AMD SVM lock. Indicates support for SVM-Lock.
|
||||
SVMNP // AMD SVM nested paging
|
||||
SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter
|
||||
SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
|
||||
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
|
||||
SYSEE // SYSENTER and SYSEXIT instructions
|
||||
TBM // AMD Trailing Bit Manipulation
|
||||
TDX_GUEST // Intel Trust Domain Extensions Guest
|
||||
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
|
||||
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
|
||||
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
|
||||
TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
|
||||
TSXLDTRK // Intel TSX Suspend Load Address Tracking
|
||||
VAES // Vector AES
|
||||
VAES // Vector AES. AVX(512) versions requires additional checks.
|
||||
VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits.
|
||||
VMPL // AMD VM Permission Levels supported
|
||||
VMSA_REGPROT // AMD VMSA Register Protection supported
|
||||
VMX // Virtual Machine Extensions
|
||||
VPCLMULQDQ // Carry-Less Multiplication Quadword
|
||||
VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
|
||||
VTE // AMD Virtual Transparent Encryption supported
|
||||
WAITPKG // TPAUSE, UMONITOR, UMWAIT
|
||||
WBNOINVD // Write Back and Do Not Invalidate Cache
|
||||
WRMSRNS // Non-Serializing Write to Model Specific Register
|
||||
X87 // FPU
|
||||
XGETBV1 // Supports XGETBV with ECX = 1
|
||||
XOP // Bulldozer XOP functions
|
||||
XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV
|
||||
XSAVEC // Supports XSAVEC and the compacted form of XRSTOR.
|
||||
XSAVEOPT // XSAVEOPT available
|
||||
XSAVES // Supports XSAVES/XRSTORS and IA32_XSS
|
||||
|
||||
// ARM features:
|
||||
AESARM // AES instructions
|
||||
@@ -174,7 +275,6 @@ const (
|
||||
SM3 // SM3 instructions
|
||||
SM4 // SM4 instructions
|
||||
SVE // Scalable Vector Extension
|
||||
|
||||
// Keep it last. It automatically defines the size of []flagSet
|
||||
lastID
|
||||
|
||||
@@ -192,8 +292,10 @@ type CPUInfo struct {
|
||||
LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable.
|
||||
Family int // CPU family number
|
||||
Model int // CPU model number
|
||||
Stepping int // CPU stepping info
|
||||
CacheLine int // Cache line size in bytes. Will be 0 if undetectable.
|
||||
Hz int64 // Clock speed, if known, 0 otherwise
|
||||
Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed.
|
||||
BoostFreq int64 // Max clock speed, if known, 0 otherwise
|
||||
Cache struct {
|
||||
L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected
|
||||
L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected
|
||||
@@ -209,6 +311,7 @@ var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
|
||||
var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32)
|
||||
var xgetbv func(index uint32) (eax, edx uint32)
|
||||
var rdtscpAsm func() (eax, ebx, ecx, edx uint32)
|
||||
var darwinHasAVX512 = func() bool { return false }
|
||||
|
||||
// CPU contains information about the CPU as detected on startup,
|
||||
// or when Detect last was called.
|
||||
@@ -292,10 +395,66 @@ func (c CPUInfo) Supports(ids ...FeatureID) bool {
|
||||
|
||||
// Has allows for checking a single feature.
|
||||
// Should be inlined by the compiler.
|
||||
func (c CPUInfo) Has(id FeatureID) bool {
|
||||
func (c *CPUInfo) Has(id FeatureID) bool {
|
||||
return c.featureSet.inSet(id)
|
||||
}
|
||||
|
||||
// AnyOf returns whether the CPU supports one or more of the requested features.
|
||||
func (c CPUInfo) AnyOf(ids ...FeatureID) bool {
|
||||
for _, id := range ids {
|
||||
if c.featureSet.inSet(id) {
|
||||
return true
|
||||
}
|
||||
}
|
||||
return false
|
||||
}
|
||||
|
||||
// Features contains several features combined for a fast check using
|
||||
// CpuInfo.HasAll
|
||||
type Features *flagSet
|
||||
|
||||
// CombineFeatures allows to combine several features for a close to constant time lookup.
|
||||
func CombineFeatures(ids ...FeatureID) Features {
|
||||
var v flagSet
|
||||
for _, id := range ids {
|
||||
v.set(id)
|
||||
}
|
||||
return &v
|
||||
}
|
||||
|
||||
func (c *CPUInfo) HasAll(f Features) bool {
|
||||
return c.featureSet.hasSetP(f)
|
||||
}
|
||||
|
||||
// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
|
||||
var oneOfLevel = CombineFeatures(SYSEE, SYSCALL)
|
||||
var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2)
|
||||
var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
|
||||
var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
|
||||
var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
|
||||
|
||||
// X64Level returns the microarchitecture level detected on the CPU.
|
||||
// If features are lacking or non x64 mode, 0 is returned.
|
||||
// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
|
||||
func (c CPUInfo) X64Level() int {
|
||||
if !c.featureSet.hasOneOf(oneOfLevel) {
|
||||
return 0
|
||||
}
|
||||
if c.featureSet.hasSetP(level4Features) {
|
||||
return 4
|
||||
}
|
||||
if c.featureSet.hasSetP(level3Features) {
|
||||
return 3
|
||||
}
|
||||
if c.featureSet.hasSetP(level2Features) {
|
||||
return 2
|
||||
}
|
||||
if c.featureSet.hasSetP(level1Features) {
|
||||
return 1
|
||||
}
|
||||
return 0
|
||||
}
|
||||
|
||||
// Disable will disable one or several features.
|
||||
func (c *CPUInfo) Disable(ids ...FeatureID) bool {
|
||||
for _, id := range ids {
|
||||
@@ -318,11 +477,10 @@ func (c CPUInfo) IsVendor(v Vendor) bool {
|
||||
return c.VendorID == v
|
||||
}
|
||||
|
||||
// FeatureSet returns all available features as strings.
|
||||
func (c CPUInfo) FeatureSet() []string {
|
||||
s := make([]string, 0)
|
||||
for _, f := range c.featureSet.Strings() {
|
||||
s = append(s, f)
|
||||
}
|
||||
s := make([]string, 0, c.featureSet.nEnabled())
|
||||
s = append(s, c.featureSet.Strings()...)
|
||||
return s
|
||||
}
|
||||
|
||||
@@ -361,25 +519,42 @@ func (c CPUInfo) LogicalCPU() int {
|
||||
return int(ebx >> 24)
|
||||
}
|
||||
|
||||
// hertz tries to compute the clock speed of the CPU. If leaf 15 is
|
||||
// frequencies tries to compute the clock speed of the CPU. If leaf 15 is
|
||||
// supported, use it, otherwise parse the brand string. Yes, really.
|
||||
func hertz(model string) int64 {
|
||||
func (c *CPUInfo) frequencies() {
|
||||
c.Hz, c.BoostFreq = 0, 0
|
||||
mfi := maxFunctionID()
|
||||
if mfi >= 0x15 {
|
||||
eax, ebx, ecx, _ := cpuid(0x15)
|
||||
if eax != 0 && ebx != 0 && ecx != 0 {
|
||||
return int64((int64(ecx) * int64(ebx)) / int64(eax))
|
||||
c.Hz = (int64(ecx) * int64(ebx)) / int64(eax)
|
||||
}
|
||||
}
|
||||
if mfi >= 0x16 {
|
||||
a, b, _, _ := cpuid(0x16)
|
||||
// Base...
|
||||
if a&0xffff > 0 {
|
||||
c.Hz = int64(a&0xffff) * 1_000_000
|
||||
}
|
||||
// Boost...
|
||||
if b&0xffff > 0 {
|
||||
c.BoostFreq = int64(b&0xffff) * 1_000_000
|
||||
}
|
||||
}
|
||||
if c.Hz > 0 {
|
||||
return
|
||||
}
|
||||
|
||||
// computeHz determines the official rated speed of a CPU from its brand
|
||||
// string. This insanity is *actually the official documented way to do
|
||||
// this according to Intel*, prior to leaf 0x15 existing. The official
|
||||
// documentation only shows this working for exactly `x.xx` or `xxxx`
|
||||
// cases, e.g., `2.50GHz` or `1300MHz`; this parser will accept other
|
||||
// sizes.
|
||||
model := c.BrandName
|
||||
hz := strings.LastIndex(model, "Hz")
|
||||
if hz < 3 {
|
||||
return 0
|
||||
return
|
||||
}
|
||||
var multiplier int64
|
||||
switch model[hz-1] {
|
||||
@@ -391,7 +566,7 @@ func hertz(model string) int64 {
|
||||
multiplier = 1000 * 1000 * 1000 * 1000
|
||||
}
|
||||
if multiplier == 0 {
|
||||
return 0
|
||||
return
|
||||
}
|
||||
freq := int64(0)
|
||||
divisor := int64(0)
|
||||
@@ -403,21 +578,22 @@ func hertz(model string) int64 {
|
||||
decimalShift *= 10
|
||||
} else if model[i] == '.' {
|
||||
if divisor != 0 {
|
||||
return 0
|
||||
return
|
||||
}
|
||||
divisor = decimalShift
|
||||
} else {
|
||||
return 0
|
||||
return
|
||||
}
|
||||
}
|
||||
// we didn't find a space
|
||||
if i < 0 {
|
||||
return 0
|
||||
return
|
||||
}
|
||||
if divisor != 0 {
|
||||
return (freq * multiplier) / divisor
|
||||
c.Hz = (freq * multiplier) / divisor
|
||||
return
|
||||
}
|
||||
return freq * multiplier
|
||||
c.Hz = freq * multiplier
|
||||
}
|
||||
|
||||
// VM Will return true if the cpu id indicates we are in
|
||||
@@ -437,7 +613,7 @@ const flagMask = flagBits - 1
|
||||
// flagSet contains detected cpu features and characteristics in an array of flags
|
||||
type flagSet [(lastID + flagMask) / flagBits]flags
|
||||
|
||||
func (s flagSet) inSet(feat FeatureID) bool {
|
||||
func (s *flagSet) inSet(feat FeatureID) bool {
|
||||
return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0
|
||||
}
|
||||
|
||||
@@ -466,6 +642,52 @@ func (s *flagSet) or(other flagSet) {
|
||||
}
|
||||
}
|
||||
|
||||
// hasSet returns whether all features are present.
|
||||
func (s *flagSet) hasSet(other flagSet) bool {
|
||||
for i, v := range other[:] {
|
||||
if s[i]&v != v {
|
||||
return false
|
||||
}
|
||||
}
|
||||
return true
|
||||
}
|
||||
|
||||
// hasSet returns whether all features are present.
|
||||
func (s *flagSet) hasSetP(other *flagSet) bool {
|
||||
for i, v := range other[:] {
|
||||
if s[i]&v != v {
|
||||
return false
|
||||
}
|
||||
}
|
||||
return true
|
||||
}
|
||||
|
||||
// hasOneOf returns whether one or more features are present.
|
||||
func (s *flagSet) hasOneOf(other *flagSet) bool {
|
||||
for i, v := range other[:] {
|
||||
if s[i]&v != 0 {
|
||||
return true
|
||||
}
|
||||
}
|
||||
return false
|
||||
}
|
||||
|
||||
// nEnabled will return the number of enabled flags.
|
||||
func (s *flagSet) nEnabled() (n int) {
|
||||
for _, v := range s[:] {
|
||||
n += bits.OnesCount64(uint64(v))
|
||||
}
|
||||
return n
|
||||
}
|
||||
|
||||
func flagSetWith(feat ...FeatureID) flagSet {
|
||||
var res flagSet
|
||||
for _, f := range feat {
|
||||
res.set(f)
|
||||
}
|
||||
return res
|
||||
}
|
||||
|
||||
// ParseFeature will parse the string and return the ID of the matching feature.
|
||||
// Will return UNKNOWN if not found.
|
||||
func ParseFeature(s string) FeatureID {
|
||||
@@ -546,7 +768,7 @@ func threadsPerCore() int {
|
||||
if vend == AMD {
|
||||
// Workaround for AMD returning 0, assume 2 if >= Zen 2
|
||||
// It will be more correct than not.
|
||||
fam, _ := familyModel()
|
||||
fam, _, _ := familyModel()
|
||||
_, _, _, d := cpuid(1)
|
||||
if (d&(1<<28)) != 0 && fam >= 23 {
|
||||
return 2
|
||||
@@ -584,14 +806,27 @@ func logicalCores() int {
|
||||
}
|
||||
}
|
||||
|
||||
func familyModel() (int, int) {
|
||||
func familyModel() (family, model, stepping int) {
|
||||
if maxFunctionID() < 0x1 {
|
||||
return 0, 0
|
||||
return 0, 0, 0
|
||||
}
|
||||
eax, _, _, _ := cpuid(1)
|
||||
family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff)
|
||||
model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0)
|
||||
return int(family), int(model)
|
||||
// If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0].
|
||||
family = int((eax >> 8) & 0xf)
|
||||
extFam := family == 0x6 // Intel is 0x6, needs extended model.
|
||||
if family == 0xf {
|
||||
// Add ExtFamily
|
||||
family += int((eax >> 20) & 0xff)
|
||||
extFam = true
|
||||
}
|
||||
// If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0].
|
||||
model = int((eax >> 4) & 0xf)
|
||||
if extFam {
|
||||
// Add ExtModel
|
||||
model += int((eax >> 12) & 0xf0)
|
||||
}
|
||||
stepping = int(eax & 0xf)
|
||||
return family, model, stepping
|
||||
}
|
||||
|
||||
func physicalCores() int {
|
||||
@@ -675,6 +910,7 @@ func (c *CPUInfo) cacheSize() {
|
||||
if maxFunctionID() < 4 {
|
||||
return
|
||||
}
|
||||
c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0
|
||||
for i := uint32(0); ; i++ {
|
||||
eax, ebx, ecx, _ := cpuidex(4, i)
|
||||
cacheType := eax & 15
|
||||
@@ -725,9 +961,14 @@ func (c *CPUInfo) cacheSize() {
|
||||
c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024)
|
||||
|
||||
// CPUID Fn8000_001D_EAX_x[N:0] Cache Properties
|
||||
if maxExtendedFunction() < 0x8000001D {
|
||||
if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) {
|
||||
return
|
||||
}
|
||||
|
||||
// Xen Hypervisor is buggy and returns the same entry no matter ECX value.
|
||||
// Hack: When we encounter the same entry 100 times we break.
|
||||
nSame := 0
|
||||
var last uint32
|
||||
for i := uint32(0); i < math.MaxUint32; i++ {
|
||||
eax, ebx, ecx, _ := cpuidex(0x8000001D, i)
|
||||
|
||||
@@ -743,6 +984,16 @@ func (c *CPUInfo) cacheSize() {
|
||||
return
|
||||
}
|
||||
|
||||
// Check for the same value repeated.
|
||||
comb := eax ^ ebx ^ ecx
|
||||
if comb == last {
|
||||
nSame++
|
||||
if nSame == 100 {
|
||||
return
|
||||
}
|
||||
}
|
||||
last = comb
|
||||
|
||||
switch level {
|
||||
case 1:
|
||||
switch typ {
|
||||
@@ -767,8 +1018,6 @@ func (c *CPUInfo) cacheSize() {
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
return
|
||||
}
|
||||
|
||||
type SGXEPCSection struct {
|
||||
@@ -829,21 +1078,26 @@ func support() flagSet {
|
||||
if mfi < 0x1 {
|
||||
return fs
|
||||
}
|
||||
family, model := familyModel()
|
||||
family, model, _ := familyModel()
|
||||
|
||||
_, _, c, d := cpuid(1)
|
||||
fs.setIf((d&(1<<0)) != 0, X87)
|
||||
fs.setIf((d&(1<<8)) != 0, CMPXCHG8)
|
||||
fs.setIf((d&(1<<11)) != 0, SYSEE)
|
||||
fs.setIf((d&(1<<15)) != 0, CMOV)
|
||||
fs.setIf((d&(1<<23)) != 0, MMX)
|
||||
fs.setIf((d&(1<<25)) != 0, MMXEXT)
|
||||
fs.setIf((d&(1<<24)) != 0, FXSR)
|
||||
fs.setIf((d&(1<<25)) != 0, FXSROPT)
|
||||
fs.setIf((d&(1<<25)) != 0, SSE)
|
||||
fs.setIf((d&(1<<26)) != 0, SSE2)
|
||||
fs.setIf((c&1) != 0, SSE3)
|
||||
fs.setIf((c&(1<<5)) != 0, VMX)
|
||||
fs.setIf((c&0x00000200) != 0, SSSE3)
|
||||
fs.setIf((c&0x00080000) != 0, SSE4)
|
||||
fs.setIf((c&0x00100000) != 0, SSE42)
|
||||
fs.setIf((c&(1<<9)) != 0, SSSE3)
|
||||
fs.setIf((c&(1<<19)) != 0, SSE4)
|
||||
fs.setIf((c&(1<<20)) != 0, SSE42)
|
||||
fs.setIf((c&(1<<25)) != 0, AESNI)
|
||||
fs.setIf((c&(1<<1)) != 0, CLMUL)
|
||||
fs.setIf(c&(1<<22) != 0, MOVBE)
|
||||
fs.setIf(c&(1<<23) != 0, POPCNT)
|
||||
fs.setIf(c&(1<<30) != 0, RDRAND)
|
||||
|
||||
@@ -859,6 +1113,8 @@ func support() flagSet {
|
||||
if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 {
|
||||
fs.setIf(threadsPerCore() > 1, HTT)
|
||||
}
|
||||
fs.setIf(c&1<<26 != 0, XSAVE)
|
||||
fs.setIf(c&1<<27 != 0, OSXSAVE)
|
||||
// Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits
|
||||
const avxCheck = 1<<26 | 1<<27 | 1<<28
|
||||
if c&avxCheck == avxCheck {
|
||||
@@ -884,7 +1140,6 @@ func support() flagSet {
|
||||
// Check AVX2, AVX2 requires OS support, but BMI1/2 don't.
|
||||
if mfi >= 7 {
|
||||
_, ebx, ecx, edx := cpuidex(7, 0)
|
||||
eax1, _, _, _ := cpuidex(7, 1)
|
||||
if fs.inSet(AVX) && (ebx&0x00000020) != 0 {
|
||||
fs.set(AVX2)
|
||||
}
|
||||
@@ -901,18 +1156,52 @@ func support() flagSet {
|
||||
fs.setIf(ebx&(1<<18) != 0, RDSEED)
|
||||
fs.setIf(ebx&(1<<19) != 0, ADX)
|
||||
fs.setIf(ebx&(1<<29) != 0, SHA)
|
||||
|
||||
// CPUID.(EAX=7, ECX=0).ECX
|
||||
fs.setIf(ecx&(1<<5) != 0, WAITPKG)
|
||||
fs.setIf(ecx&(1<<7) != 0, CETSS)
|
||||
fs.setIf(ecx&(1<<8) != 0, GFNI)
|
||||
fs.setIf(ecx&(1<<9) != 0, VAES)
|
||||
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
|
||||
fs.setIf(ecx&(1<<13) != 0, TME)
|
||||
fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
|
||||
fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
|
||||
fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
|
||||
fs.setIf(ecx&(1<<29) != 0, ENQCMD)
|
||||
fs.setIf(ecx&(1<<30) != 0, SGXLC)
|
||||
|
||||
// CPUID.(EAX=7, ECX=0).EDX
|
||||
fs.setIf(edx&(1<<4) != 0, FSRM)
|
||||
fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL)
|
||||
fs.setIf(edx&(1<<10) != 0, MD_CLEAR)
|
||||
fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT)
|
||||
fs.setIf(edx&(1<<14) != 0, SERIALIZE)
|
||||
fs.setIf(edx&(1<<15) != 0, HYBRID_CPU)
|
||||
fs.setIf(edx&(1<<16) != 0, TSXLDTRK)
|
||||
fs.setIf(edx&(1<<18) != 0, PCONFIG)
|
||||
fs.setIf(edx&(1<<20) != 0, CETIBT)
|
||||
fs.setIf(edx&(1<<26) != 0, IBPB)
|
||||
fs.setIf(edx&(1<<27) != 0, STIBP)
|
||||
fs.setIf(edx&(1<<28) != 0, FLUSH_L1D)
|
||||
fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP)
|
||||
fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
|
||||
fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
|
||||
|
||||
// CPUID.(EAX=7, ECX=1).EAX
|
||||
eax1, _, _, edx1 := cpuidex(7, 1)
|
||||
fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
|
||||
fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
|
||||
fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
|
||||
fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT)
|
||||
fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT)
|
||||
fs.setIf(eax1&(1<<22) != 0, HRESET)
|
||||
fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
|
||||
fs.setIf(eax1&(1<<26) != 0, LAM)
|
||||
|
||||
// CPUID.(EAX=7, ECX=1).EDX
|
||||
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
|
||||
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
|
||||
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
|
||||
|
||||
// Only detect AVX-512 features if XGETBV is supported
|
||||
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
|
||||
@@ -922,7 +1211,11 @@ func support() flagSet {
|
||||
// Verify that XCR0[7:5] = ‘111b’ (OPMASK state, upper 256-bit of ZMM0-ZMM15 and
|
||||
// ZMM16-ZMM31 state are enabled by OS)
|
||||
/// and that XCR0[2:1] = ‘11b’ (XMM state and YMM state are enabled by OS).
|
||||
if (eax>>5)&7 == 7 && (eax>>1)&3 == 3 {
|
||||
hasAVX512 := (eax>>5)&7 == 7 && (eax>>1)&3 == 3
|
||||
if runtime.GOOS == "darwin" {
|
||||
hasAVX512 = fs.inSet(AVX) && darwinHasAVX512()
|
||||
}
|
||||
if hasAVX512 {
|
||||
fs.setIf(ebx&(1<<16) != 0, AVX512F)
|
||||
fs.setIf(ebx&(1<<17) != 0, AVX512DQ)
|
||||
fs.setIf(ebx&(1<<21) != 0, AVX512IFMA)
|
||||
@@ -934,49 +1227,137 @@ func support() flagSet {
|
||||
// ecx
|
||||
fs.setIf(ecx&(1<<1) != 0, AVX512VBMI)
|
||||
fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2)
|
||||
fs.setIf(ecx&(1<<8) != 0, GFNI)
|
||||
fs.setIf(ecx&(1<<9) != 0, VAES)
|
||||
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
|
||||
fs.setIf(ecx&(1<<11) != 0, AVX512VNNI)
|
||||
fs.setIf(ecx&(1<<12) != 0, AVX512BITALG)
|
||||
fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ)
|
||||
// edx
|
||||
fs.setIf(edx&(1<<8) != 0, AVX512VP2INTERSECT)
|
||||
fs.setIf(edx&(1<<22) != 0, AMXBF16)
|
||||
fs.setIf(edx&(1<<23) != 0, AVX512FP16)
|
||||
fs.setIf(edx&(1<<24) != 0, AMXTILE)
|
||||
fs.setIf(edx&(1<<25) != 0, AMXINT8)
|
||||
// eax1 = CPUID.(EAX=7, ECX=1).EAX
|
||||
fs.setIf(eax1&(1<<5) != 0, AVX512BF16)
|
||||
fs.setIf(eax1&(1<<19) != 0, WRMSRNS)
|
||||
fs.setIf(eax1&(1<<21) != 0, AMXFP16)
|
||||
fs.setIf(eax1&(1<<27) != 0, MSRLIST)
|
||||
}
|
||||
}
|
||||
|
||||
// CPUID.(EAX=7, ECX=2)
|
||||
_, _, _, edx = cpuidex(7, 2)
|
||||
fs.setIf(edx&(1<<0) != 0, PSFD)
|
||||
fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL)
|
||||
fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL)
|
||||
fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
|
||||
fs.setIf(edx&(1<<5) != 0, MCDT_NO)
|
||||
|
||||
}
|
||||
|
||||
// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
|
||||
// EAX
|
||||
// Bit 00: XSAVEOPT is available.
|
||||
// Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set.
|
||||
// Bit 02: Supports XGETBV with ECX = 1 if set.
|
||||
// Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set.
|
||||
// Bits 31 - 04: Reserved.
|
||||
// EBX
|
||||
// Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS.
|
||||
// ECX
|
||||
// Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1.
|
||||
// EDX?
|
||||
// Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved.
|
||||
if mfi >= 0xd {
|
||||
if fs.inSet(XSAVE) {
|
||||
eax, _, _, _ := cpuidex(0xd, 1)
|
||||
fs.setIf(eax&(1<<0) != 0, XSAVEOPT)
|
||||
fs.setIf(eax&(1<<1) != 0, XSAVEC)
|
||||
fs.setIf(eax&(1<<2) != 0, XGETBV1)
|
||||
fs.setIf(eax&(1<<3) != 0, XSAVES)
|
||||
}
|
||||
}
|
||||
if maxExtendedFunction() >= 0x80000001 {
|
||||
_, _, c, d := cpuid(0x80000001)
|
||||
if (c & (1 << 5)) != 0 {
|
||||
fs.set(LZCNT)
|
||||
fs.set(POPCNT)
|
||||
}
|
||||
fs.setIf((c&(1<<10)) != 0, IBS)
|
||||
fs.setIf((d&(1<<31)) != 0, AMD3DNOW)
|
||||
fs.setIf((d&(1<<30)) != 0, AMD3DNOWEXT)
|
||||
fs.setIf((d&(1<<23)) != 0, MMX)
|
||||
fs.setIf((d&(1<<22)) != 0, MMXEXT)
|
||||
// ECX
|
||||
fs.setIf((c&(1<<0)) != 0, LAHF)
|
||||
fs.setIf((c&(1<<2)) != 0, SVM)
|
||||
fs.setIf((c&(1<<6)) != 0, SSE4A)
|
||||
fs.setIf((c&(1<<10)) != 0, IBS)
|
||||
fs.setIf((c&(1<<22)) != 0, TOPEXT)
|
||||
|
||||
// EDX
|
||||
fs.setIf(d&(1<<11) != 0, SYSCALL)
|
||||
fs.setIf(d&(1<<20) != 0, NX)
|
||||
fs.setIf(d&(1<<22) != 0, MMXEXT)
|
||||
fs.setIf(d&(1<<23) != 0, MMX)
|
||||
fs.setIf(d&(1<<24) != 0, FXSR)
|
||||
fs.setIf(d&(1<<25) != 0, FXSROPT)
|
||||
fs.setIf(d&(1<<27) != 0, RDTSCP)
|
||||
fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT)
|
||||
fs.setIf(d&(1<<31) != 0, AMD3DNOW)
|
||||
|
||||
/* XOP and FMA4 use the AVX instruction coding scheme, so they can't be
|
||||
* used unless the OS has AVX support. */
|
||||
if fs.inSet(AVX) {
|
||||
fs.setIf((c&0x00000800) != 0, XOP)
|
||||
fs.setIf((c&0x00010000) != 0, FMA4)
|
||||
fs.setIf((c&(1<<11)) != 0, XOP)
|
||||
fs.setIf((c&(1<<16)) != 0, FMA4)
|
||||
}
|
||||
|
||||
}
|
||||
if maxExtendedFunction() >= 0x80000007 {
|
||||
_, b, _, d := cpuid(0x80000007)
|
||||
fs.setIf((b&(1<<0)) != 0, MCAOVERFLOW)
|
||||
fs.setIf((b&(1<<1)) != 0, SUCCOR)
|
||||
fs.setIf((b&(1<<2)) != 0, HWA)
|
||||
fs.setIf((d&(1<<9)) != 0, CPBOOST)
|
||||
}
|
||||
|
||||
if maxExtendedFunction() >= 0x80000008 {
|
||||
_, b, _, _ := cpuid(0x80000008)
|
||||
fs.setIf(b&(1<<28) != 0, PSFD)
|
||||
fs.setIf(b&(1<<27) != 0, CPPC)
|
||||
fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD)
|
||||
fs.setIf(b&(1<<23) != 0, PPIN)
|
||||
fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED)
|
||||
fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS)
|
||||
fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP)
|
||||
fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED)
|
||||
fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON)
|
||||
fs.setIf(b&(1<<15) != 0, STIBP)
|
||||
fs.setIf(b&(1<<14) != 0, IBRS)
|
||||
fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
|
||||
fs.setIf(b&(1<<12) != 0, IBPB)
|
||||
fs.setIf((b&(1<<9)) != 0, WBNOINVD)
|
||||
fs.setIf((b&(1<<8)) != 0, MCOMMIT)
|
||||
fs.setIf((b&(1<<4)) != 0, RDPRU)
|
||||
fs.setIf((b&(1<<3)) != 0, INVLPGB)
|
||||
fs.setIf((b&(1<<1)) != 0, MSRIRC)
|
||||
fs.setIf((b&(1<<0)) != 0, CLZERO)
|
||||
}
|
||||
|
||||
if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A {
|
||||
_, _, _, edx := cpuid(0x8000000A)
|
||||
fs.setIf((edx>>0)&1 == 1, SVMNP)
|
||||
fs.setIf((edx>>1)&1 == 1, LBRVIRT)
|
||||
fs.setIf((edx>>2)&1 == 1, SVML)
|
||||
fs.setIf((edx>>3)&1 == 1, NRIPS)
|
||||
fs.setIf((edx>>4)&1 == 1, TSCRATEMSR)
|
||||
fs.setIf((edx>>5)&1 == 1, VMCBCLEAN)
|
||||
fs.setIf((edx>>6)&1 == 1, SVMFBASID)
|
||||
fs.setIf((edx>>7)&1 == 1, SVMDA)
|
||||
fs.setIf((edx>>10)&1 == 1, SVMPF)
|
||||
fs.setIf((edx>>12)&1 == 1, SVMPFT)
|
||||
}
|
||||
|
||||
if maxExtendedFunction() >= 0x8000001a {
|
||||
eax, _, _, _ := cpuid(0x8000001a)
|
||||
fs.setIf((eax>>0)&1 == 1, FP128)
|
||||
fs.setIf((eax>>1)&1 == 1, MOVU)
|
||||
fs.setIf((eax>>2)&1 == 1, FP256)
|
||||
}
|
||||
|
||||
if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) {
|
||||
@@ -989,6 +1370,35 @@ func support() flagSet {
|
||||
fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT)
|
||||
fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT)
|
||||
fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK)
|
||||
fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE)
|
||||
fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX)
|
||||
fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1.
|
||||
fs.setIf((eax>>11)&1 == 1, IBS_ZEN4)
|
||||
}
|
||||
|
||||
if maxExtendedFunction() >= 0x8000001f && vend == AMD {
|
||||
a, _, _, _ := cpuid(0x8000001f)
|
||||
fs.setIf((a>>0)&1 == 1, SME)
|
||||
fs.setIf((a>>1)&1 == 1, SEV)
|
||||
fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH)
|
||||
fs.setIf((a>>3)&1 == 1, SEV_ES)
|
||||
fs.setIf((a>>4)&1 == 1, SEV_SNP)
|
||||
fs.setIf((a>>5)&1 == 1, VMPL)
|
||||
fs.setIf((a>>10)&1 == 1, SME_COHERENT)
|
||||
fs.setIf((a>>11)&1 == 1, SEV_64BIT)
|
||||
fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED)
|
||||
fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE)
|
||||
fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP)
|
||||
fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST)
|
||||
fs.setIf((a>>16)&1 == 1, VTE)
|
||||
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
|
||||
}
|
||||
|
||||
if mfi >= 0x21 {
|
||||
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
|
||||
_, ebx, ecx, edx := cpuid(0x21)
|
||||
identity := string(valAsString(ebx, edx, ecx))
|
||||
fs.setIf(identity == "IntelTDX ", TDX_GUEST)
|
||||
}
|
||||
|
||||
return fs
|
||||
|
||||
5
vendor/github.com/klauspost/cpuid/v2/cpuid_386.s
generated
vendored
5
vendor/github.com/klauspost/cpuid/v2/cpuid_386.s
generated
vendored
@@ -40,3 +40,8 @@ TEXT ·asmRdtscpAsm(SB), 7, $0
|
||||
MOVL CX, ecx+8(FP)
|
||||
MOVL DX, edx+12(FP)
|
||||
RET
|
||||
|
||||
// func asmDarwinHasAVX512() bool
|
||||
TEXT ·asmDarwinHasAVX512(SB), 7, $0
|
||||
MOVL $0, eax+0(FP)
|
||||
RET
|
||||
|
||||
30
vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s
generated
vendored
30
vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s
generated
vendored
@@ -40,3 +40,33 @@ TEXT ·asmRdtscpAsm(SB), 7, $0
|
||||
MOVL CX, ecx+8(FP)
|
||||
MOVL DX, edx+12(FP)
|
||||
RET
|
||||
|
||||
// From https://go-review.googlesource.com/c/sys/+/285572/
|
||||
// func asmDarwinHasAVX512() bool
|
||||
TEXT ·asmDarwinHasAVX512(SB), 7, $0-1
|
||||
MOVB $0, ret+0(FP) // default to false
|
||||
|
||||
#ifdef GOOS_darwin // return if not darwin
|
||||
#ifdef GOARCH_amd64 // return if not amd64
|
||||
// These values from:
|
||||
// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h
|
||||
#define commpage64_base_address 0x00007fffffe00000
|
||||
#define commpage64_cpu_capabilities64 (commpage64_base_address+0x010)
|
||||
#define commpage64_version (commpage64_base_address+0x01E)
|
||||
#define hasAVX512F 0x0000004000000000
|
||||
MOVQ $commpage64_version, BX
|
||||
MOVW (BX), AX
|
||||
CMPW AX, $13 // versions < 13 do not support AVX512
|
||||
JL no_avx512
|
||||
MOVQ $commpage64_cpu_capabilities64, BX
|
||||
MOVQ (BX), AX
|
||||
MOVQ $hasAVX512F, CX
|
||||
ANDQ CX, AX
|
||||
JZ no_avx512
|
||||
MOVB $1, ret+0(FP)
|
||||
|
||||
no_avx512:
|
||||
#endif
|
||||
#endif
|
||||
RET
|
||||
|
||||
|
||||
3
vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
generated
vendored
3
vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
generated
vendored
@@ -1,6 +1,7 @@
|
||||
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//+build arm64,!gccgo,!noasm,!appengine
|
||||
//go:build arm64 && !gccgo && !noasm && !appengine
|
||||
// +build arm64,!gccgo,!noasm,!appengine
|
||||
|
||||
package cpuid
|
||||
|
||||
|
||||
3
vendor/github.com/klauspost/cpuid/v2/detect_ref.go
generated
vendored
3
vendor/github.com/klauspost/cpuid/v2/detect_ref.go
generated
vendored
@@ -1,6 +1,7 @@
|
||||
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//+build !amd64,!386,!arm64 gccgo noasm appengine
|
||||
//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine
|
||||
// +build !amd64,!386,!arm64 gccgo noasm appengine
|
||||
|
||||
package cpuid
|
||||
|
||||
|
||||
9
vendor/github.com/klauspost/cpuid/v2/detect_x86.go
generated
vendored
9
vendor/github.com/klauspost/cpuid/v2/detect_x86.go
generated
vendored
@@ -1,6 +1,7 @@
|
||||
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//+build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
|
||||
//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine)
|
||||
// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
|
||||
|
||||
package cpuid
|
||||
|
||||
@@ -8,12 +9,14 @@ func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
|
||||
func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
|
||||
func asmXgetbv(index uint32) (eax, edx uint32)
|
||||
func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
|
||||
func asmDarwinHasAVX512() bool
|
||||
|
||||
func initCPU() {
|
||||
cpuid = asmCpuid
|
||||
cpuidex = asmCpuidex
|
||||
xgetbv = asmXgetbv
|
||||
rdtscpAsm = asmRdtscpAsm
|
||||
darwinHasAVX512 = asmDarwinHasAVX512
|
||||
}
|
||||
|
||||
func addInfo(c *CPUInfo, safe bool) {
|
||||
@@ -21,13 +24,13 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
c.maxExFunc = maxExtendedFunction()
|
||||
c.BrandName = brandName()
|
||||
c.CacheLine = cacheLine()
|
||||
c.Family, c.Model = familyModel()
|
||||
c.Family, c.Model, c.Stepping = familyModel()
|
||||
c.featureSet = support()
|
||||
c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
|
||||
c.ThreadsPerCore = threadsPerCore()
|
||||
c.LogicalCores = logicalCores()
|
||||
c.PhysicalCores = physicalCores()
|
||||
c.VendorID, c.VendorString = vendorID()
|
||||
c.Hz = hertz(c.BrandName)
|
||||
c.cacheSize()
|
||||
c.frequencies()
|
||||
}
|
||||
|
||||
307
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
307
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
@@ -13,114 +13,213 @@ func _() {
|
||||
_ = x[AMD3DNOW-3]
|
||||
_ = x[AMD3DNOWEXT-4]
|
||||
_ = x[AMXBF16-5]
|
||||
_ = x[AMXINT8-6]
|
||||
_ = x[AMXTILE-7]
|
||||
_ = x[AVX-8]
|
||||
_ = x[AVX2-9]
|
||||
_ = x[AVX512BF16-10]
|
||||
_ = x[AVX512BITALG-11]
|
||||
_ = x[AVX512BW-12]
|
||||
_ = x[AVX512CD-13]
|
||||
_ = x[AVX512DQ-14]
|
||||
_ = x[AVX512ER-15]
|
||||
_ = x[AVX512F-16]
|
||||
_ = x[AVX512IFMA-17]
|
||||
_ = x[AVX512PF-18]
|
||||
_ = x[AVX512VBMI-19]
|
||||
_ = x[AVX512VBMI2-20]
|
||||
_ = x[AVX512VL-21]
|
||||
_ = x[AVX512VNNI-22]
|
||||
_ = x[AVX512VP2INTERSECT-23]
|
||||
_ = x[AVX512VPOPCNTDQ-24]
|
||||
_ = x[AVXSLOW-25]
|
||||
_ = x[BMI1-26]
|
||||
_ = x[BMI2-27]
|
||||
_ = x[CLDEMOTE-28]
|
||||
_ = x[CLMUL-29]
|
||||
_ = x[CMOV-30]
|
||||
_ = x[CX16-31]
|
||||
_ = x[ENQCMD-32]
|
||||
_ = x[ERMS-33]
|
||||
_ = x[F16C-34]
|
||||
_ = x[FMA3-35]
|
||||
_ = x[FMA4-36]
|
||||
_ = x[GFNI-37]
|
||||
_ = x[HLE-38]
|
||||
_ = x[HTT-39]
|
||||
_ = x[HYPERVISOR-40]
|
||||
_ = x[IBPB-41]
|
||||
_ = x[IBS-42]
|
||||
_ = x[IBSBRNTRGT-43]
|
||||
_ = x[IBSFETCHSAM-44]
|
||||
_ = x[IBSFFV-45]
|
||||
_ = x[IBSOPCNT-46]
|
||||
_ = x[IBSOPCNTEXT-47]
|
||||
_ = x[IBSOPSAM-48]
|
||||
_ = x[IBSRDWROPCNT-49]
|
||||
_ = x[IBSRIPINVALIDCHK-50]
|
||||
_ = x[LZCNT-51]
|
||||
_ = x[MMX-52]
|
||||
_ = x[MMXEXT-53]
|
||||
_ = x[MOVDIR64B-54]
|
||||
_ = x[MOVDIRI-55]
|
||||
_ = x[MPX-56]
|
||||
_ = x[NX-57]
|
||||
_ = x[POPCNT-58]
|
||||
_ = x[RDRAND-59]
|
||||
_ = x[RDSEED-60]
|
||||
_ = x[RDTSCP-61]
|
||||
_ = x[RTM-62]
|
||||
_ = x[SERIALIZE-63]
|
||||
_ = x[SGX-64]
|
||||
_ = x[SGXLC-65]
|
||||
_ = x[SHA-66]
|
||||
_ = x[SSE-67]
|
||||
_ = x[SSE2-68]
|
||||
_ = x[SSE3-69]
|
||||
_ = x[SSE4-70]
|
||||
_ = x[SSE42-71]
|
||||
_ = x[SSE4A-72]
|
||||
_ = x[SSSE3-73]
|
||||
_ = x[STIBP-74]
|
||||
_ = x[TBM-75]
|
||||
_ = x[TSXLDTRK-76]
|
||||
_ = x[VAES-77]
|
||||
_ = x[VMX-78]
|
||||
_ = x[VPCLMULQDQ-79]
|
||||
_ = x[WAITPKG-80]
|
||||
_ = x[WBNOINVD-81]
|
||||
_ = x[XOP-82]
|
||||
_ = x[AESARM-83]
|
||||
_ = x[ARMCPUID-84]
|
||||
_ = x[ASIMD-85]
|
||||
_ = x[ASIMDDP-86]
|
||||
_ = x[ASIMDHP-87]
|
||||
_ = x[ASIMDRDM-88]
|
||||
_ = x[ATOMICS-89]
|
||||
_ = x[CRC32-90]
|
||||
_ = x[DCPOP-91]
|
||||
_ = x[EVTSTRM-92]
|
||||
_ = x[FCMA-93]
|
||||
_ = x[FP-94]
|
||||
_ = x[FPHP-95]
|
||||
_ = x[GPA-96]
|
||||
_ = x[JSCVT-97]
|
||||
_ = x[LRCPC-98]
|
||||
_ = x[PMULL-99]
|
||||
_ = x[SHA1-100]
|
||||
_ = x[SHA2-101]
|
||||
_ = x[SHA3-102]
|
||||
_ = x[SHA512-103]
|
||||
_ = x[SM3-104]
|
||||
_ = x[SM4-105]
|
||||
_ = x[SVE-106]
|
||||
_ = x[lastID-107]
|
||||
_ = x[AMXFP16-6]
|
||||
_ = x[AMXINT8-7]
|
||||
_ = x[AMXTILE-8]
|
||||
_ = x[AVX-9]
|
||||
_ = x[AVX2-10]
|
||||
_ = x[AVX512BF16-11]
|
||||
_ = x[AVX512BITALG-12]
|
||||
_ = x[AVX512BW-13]
|
||||
_ = x[AVX512CD-14]
|
||||
_ = x[AVX512DQ-15]
|
||||
_ = x[AVX512ER-16]
|
||||
_ = x[AVX512F-17]
|
||||
_ = x[AVX512FP16-18]
|
||||
_ = x[AVX512IFMA-19]
|
||||
_ = x[AVX512PF-20]
|
||||
_ = x[AVX512VBMI-21]
|
||||
_ = x[AVX512VBMI2-22]
|
||||
_ = x[AVX512VL-23]
|
||||
_ = x[AVX512VNNI-24]
|
||||
_ = x[AVX512VP2INTERSECT-25]
|
||||
_ = x[AVX512VPOPCNTDQ-26]
|
||||
_ = x[AVXIFMA-27]
|
||||
_ = x[AVXNECONVERT-28]
|
||||
_ = x[AVXSLOW-29]
|
||||
_ = x[AVXVNNI-30]
|
||||
_ = x[AVXVNNIINT8-31]
|
||||
_ = x[BHI_CTRL-32]
|
||||
_ = x[BMI1-33]
|
||||
_ = x[BMI2-34]
|
||||
_ = x[CETIBT-35]
|
||||
_ = x[CETSS-36]
|
||||
_ = x[CLDEMOTE-37]
|
||||
_ = x[CLMUL-38]
|
||||
_ = x[CLZERO-39]
|
||||
_ = x[CMOV-40]
|
||||
_ = x[CMPCCXADD-41]
|
||||
_ = x[CMPSB_SCADBS_SHORT-42]
|
||||
_ = x[CMPXCHG8-43]
|
||||
_ = x[CPBOOST-44]
|
||||
_ = x[CPPC-45]
|
||||
_ = x[CX16-46]
|
||||
_ = x[EFER_LMSLE_UNS-47]
|
||||
_ = x[ENQCMD-48]
|
||||
_ = x[ERMS-49]
|
||||
_ = x[F16C-50]
|
||||
_ = x[FLUSH_L1D-51]
|
||||
_ = x[FMA3-52]
|
||||
_ = x[FMA4-53]
|
||||
_ = x[FP128-54]
|
||||
_ = x[FP256-55]
|
||||
_ = x[FSRM-56]
|
||||
_ = x[FXSR-57]
|
||||
_ = x[FXSROPT-58]
|
||||
_ = x[GFNI-59]
|
||||
_ = x[HLE-60]
|
||||
_ = x[HRESET-61]
|
||||
_ = x[HTT-62]
|
||||
_ = x[HWA-63]
|
||||
_ = x[HYBRID_CPU-64]
|
||||
_ = x[HYPERVISOR-65]
|
||||
_ = x[IA32_ARCH_CAP-66]
|
||||
_ = x[IA32_CORE_CAP-67]
|
||||
_ = x[IBPB-68]
|
||||
_ = x[IBRS-69]
|
||||
_ = x[IBRS_PREFERRED-70]
|
||||
_ = x[IBRS_PROVIDES_SMP-71]
|
||||
_ = x[IBS-72]
|
||||
_ = x[IBSBRNTRGT-73]
|
||||
_ = x[IBSFETCHSAM-74]
|
||||
_ = x[IBSFFV-75]
|
||||
_ = x[IBSOPCNT-76]
|
||||
_ = x[IBSOPCNTEXT-77]
|
||||
_ = x[IBSOPSAM-78]
|
||||
_ = x[IBSRDWROPCNT-79]
|
||||
_ = x[IBSRIPINVALIDCHK-80]
|
||||
_ = x[IBS_FETCH_CTLX-81]
|
||||
_ = x[IBS_OPDATA4-82]
|
||||
_ = x[IBS_OPFUSE-83]
|
||||
_ = x[IBS_PREVENTHOST-84]
|
||||
_ = x[IBS_ZEN4-85]
|
||||
_ = x[IDPRED_CTRL-86]
|
||||
_ = x[INT_WBINVD-87]
|
||||
_ = x[INVLPGB-88]
|
||||
_ = x[LAHF-89]
|
||||
_ = x[LAM-90]
|
||||
_ = x[LBRVIRT-91]
|
||||
_ = x[LZCNT-92]
|
||||
_ = x[MCAOVERFLOW-93]
|
||||
_ = x[MCDT_NO-94]
|
||||
_ = x[MCOMMIT-95]
|
||||
_ = x[MD_CLEAR-96]
|
||||
_ = x[MMX-97]
|
||||
_ = x[MMXEXT-98]
|
||||
_ = x[MOVBE-99]
|
||||
_ = x[MOVDIR64B-100]
|
||||
_ = x[MOVDIRI-101]
|
||||
_ = x[MOVSB_ZL-102]
|
||||
_ = x[MOVU-103]
|
||||
_ = x[MPX-104]
|
||||
_ = x[MSRIRC-105]
|
||||
_ = x[MSRLIST-106]
|
||||
_ = x[MSR_PAGEFLUSH-107]
|
||||
_ = x[NRIPS-108]
|
||||
_ = x[NX-109]
|
||||
_ = x[OSXSAVE-110]
|
||||
_ = x[PCONFIG-111]
|
||||
_ = x[POPCNT-112]
|
||||
_ = x[PPIN-113]
|
||||
_ = x[PREFETCHI-114]
|
||||
_ = x[PSFD-115]
|
||||
_ = x[RDPRU-116]
|
||||
_ = x[RDRAND-117]
|
||||
_ = x[RDSEED-118]
|
||||
_ = x[RDTSCP-119]
|
||||
_ = x[RRSBA_CTRL-120]
|
||||
_ = x[RTM-121]
|
||||
_ = x[RTM_ALWAYS_ABORT-122]
|
||||
_ = x[SERIALIZE-123]
|
||||
_ = x[SEV-124]
|
||||
_ = x[SEV_64BIT-125]
|
||||
_ = x[SEV_ALTERNATIVE-126]
|
||||
_ = x[SEV_DEBUGSWAP-127]
|
||||
_ = x[SEV_ES-128]
|
||||
_ = x[SEV_RESTRICTED-129]
|
||||
_ = x[SEV_SNP-130]
|
||||
_ = x[SGX-131]
|
||||
_ = x[SGXLC-132]
|
||||
_ = x[SHA-133]
|
||||
_ = x[SME-134]
|
||||
_ = x[SME_COHERENT-135]
|
||||
_ = x[SPEC_CTRL_SSBD-136]
|
||||
_ = x[SRBDS_CTRL-137]
|
||||
_ = x[SSE-138]
|
||||
_ = x[SSE2-139]
|
||||
_ = x[SSE3-140]
|
||||
_ = x[SSE4-141]
|
||||
_ = x[SSE42-142]
|
||||
_ = x[SSE4A-143]
|
||||
_ = x[SSSE3-144]
|
||||
_ = x[STIBP-145]
|
||||
_ = x[STIBP_ALWAYSON-146]
|
||||
_ = x[STOSB_SHORT-147]
|
||||
_ = x[SUCCOR-148]
|
||||
_ = x[SVM-149]
|
||||
_ = x[SVMDA-150]
|
||||
_ = x[SVMFBASID-151]
|
||||
_ = x[SVML-152]
|
||||
_ = x[SVMNP-153]
|
||||
_ = x[SVMPF-154]
|
||||
_ = x[SVMPFT-155]
|
||||
_ = x[SYSCALL-156]
|
||||
_ = x[SYSEE-157]
|
||||
_ = x[TBM-158]
|
||||
_ = x[TDX_GUEST-159]
|
||||
_ = x[TLB_FLUSH_NESTED-160]
|
||||
_ = x[TME-161]
|
||||
_ = x[TOPEXT-162]
|
||||
_ = x[TSCRATEMSR-163]
|
||||
_ = x[TSXLDTRK-164]
|
||||
_ = x[VAES-165]
|
||||
_ = x[VMCBCLEAN-166]
|
||||
_ = x[VMPL-167]
|
||||
_ = x[VMSA_REGPROT-168]
|
||||
_ = x[VMX-169]
|
||||
_ = x[VPCLMULQDQ-170]
|
||||
_ = x[VTE-171]
|
||||
_ = x[WAITPKG-172]
|
||||
_ = x[WBNOINVD-173]
|
||||
_ = x[WRMSRNS-174]
|
||||
_ = x[X87-175]
|
||||
_ = x[XGETBV1-176]
|
||||
_ = x[XOP-177]
|
||||
_ = x[XSAVE-178]
|
||||
_ = x[XSAVEC-179]
|
||||
_ = x[XSAVEOPT-180]
|
||||
_ = x[XSAVES-181]
|
||||
_ = x[AESARM-182]
|
||||
_ = x[ARMCPUID-183]
|
||||
_ = x[ASIMD-184]
|
||||
_ = x[ASIMDDP-185]
|
||||
_ = x[ASIMDHP-186]
|
||||
_ = x[ASIMDRDM-187]
|
||||
_ = x[ATOMICS-188]
|
||||
_ = x[CRC32-189]
|
||||
_ = x[DCPOP-190]
|
||||
_ = x[EVTSTRM-191]
|
||||
_ = x[FCMA-192]
|
||||
_ = x[FP-193]
|
||||
_ = x[FPHP-194]
|
||||
_ = x[GPA-195]
|
||||
_ = x[JSCVT-196]
|
||||
_ = x[LRCPC-197]
|
||||
_ = x[PMULL-198]
|
||||
_ = x[SHA1-199]
|
||||
_ = x[SHA2-200]
|
||||
_ = x[SHA3-201]
|
||||
_ = x[SHA512-202]
|
||||
_ = x[SM3-203]
|
||||
_ = x[SM4-204]
|
||||
_ = x[SVE-205]
|
||||
_ = x[lastID-206]
|
||||
_ = x[firstID-0]
|
||||
}
|
||||
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWBMI1BMI2CLDEMOTECLMULCMOVCX16ENQCMDERMSF16CFMA3FMA4GFNIHLEHTTHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKLZCNTMMXMMXEXTMOVDIR64BMOVDIRIMPXNXPOPCNTRDRANDRDSEEDRDTSCPRTMSERIALIZESGXSGXLCSHASSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPTBMTSXLDTRKVAESVMXVPCLMULQDQWAITPKGWBNOINVDXOPAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 141, 151, 162, 170, 180, 198, 213, 220, 224, 228, 236, 241, 245, 249, 255, 259, 263, 267, 271, 275, 278, 281, 291, 295, 298, 308, 319, 325, 333, 344, 352, 364, 380, 385, 388, 394, 403, 410, 413, 415, 421, 427, 433, 439, 442, 451, 454, 459, 462, 465, 469, 473, 477, 482, 487, 492, 497, 500, 508, 512, 515, 525, 532, 540, 543, 549, 557, 562, 569, 576, 584, 591, 596, 601, 608, 612, 614, 618, 621, 626, 631, 636, 640, 644, 648, 654, 657, 660, 663, 669}
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
|
||||
|
||||
func (i FeatureID) String() string {
|
||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||
|
||||
108
vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
generated
vendored
108
vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
generated
vendored
@@ -2,14 +2,120 @@
|
||||
|
||||
package cpuid
|
||||
|
||||
import "runtime"
|
||||
import (
|
||||
"runtime"
|
||||
"strings"
|
||||
|
||||
"golang.org/x/sys/unix"
|
||||
)
|
||||
|
||||
func detectOS(c *CPUInfo) bool {
|
||||
if runtime.GOOS != "ios" {
|
||||
tryToFillCPUInfoFomSysctl(c)
|
||||
}
|
||||
// There are no hw.optional sysctl values for the below features on Mac OS 11.0
|
||||
// to detect their supported state dynamically. Assume the CPU features that
|
||||
// Apple Silicon M1 supports to be available as a minimal set of features
|
||||
// to all Go programs running on darwin/arm64.
|
||||
// TODO: Add more if we know them.
|
||||
c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2)
|
||||
|
||||
return true
|
||||
}
|
||||
|
||||
func sysctlGetBool(name string) bool {
|
||||
value, err := unix.SysctlUint32(name)
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
return value != 0
|
||||
}
|
||||
|
||||
func sysctlGetString(name string) string {
|
||||
value, err := unix.Sysctl(name)
|
||||
if err != nil {
|
||||
return ""
|
||||
}
|
||||
return value
|
||||
}
|
||||
|
||||
func sysctlGetInt(unknown int, names ...string) int {
|
||||
for _, name := range names {
|
||||
value, err := unix.SysctlUint32(name)
|
||||
if err != nil {
|
||||
continue
|
||||
}
|
||||
if value != 0 {
|
||||
return int(value)
|
||||
}
|
||||
}
|
||||
return unknown
|
||||
}
|
||||
|
||||
func sysctlGetInt64(unknown int, names ...string) int {
|
||||
for _, name := range names {
|
||||
value64, err := unix.SysctlUint64(name)
|
||||
if err != nil {
|
||||
continue
|
||||
}
|
||||
if int(value64) != unknown {
|
||||
return int(value64)
|
||||
}
|
||||
}
|
||||
return unknown
|
||||
}
|
||||
|
||||
func setFeature(c *CPUInfo, name string, feature FeatureID) {
|
||||
c.featureSet.setIf(sysctlGetBool(name), feature)
|
||||
}
|
||||
func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
|
||||
c.BrandName = sysctlGetString("machdep.cpu.brand_string")
|
||||
|
||||
if len(c.BrandName) != 0 {
|
||||
c.VendorString = strings.Fields(c.BrandName)[0]
|
||||
}
|
||||
|
||||
c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu")
|
||||
c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") /
|
||||
sysctlGetInt(1, "hw.physicalcpu")
|
||||
c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count")
|
||||
c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily")
|
||||
c.Model = sysctlGetInt(0, "machdep.cpu.model")
|
||||
c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
|
||||
c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
|
||||
c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
|
||||
c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
|
||||
c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
|
||||
|
||||
// from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile
|
||||
setFeature(c, "hw.optional.arm.FEAT_AES", AESARM)
|
||||
setFeature(c, "hw.optional.AdvSIMD", ASIMD)
|
||||
setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP)
|
||||
setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM)
|
||||
setFeature(c, "hw.optional.FEAT_CRC32", CRC32)
|
||||
setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP)
|
||||
// setFeature(c, "", EVTSTRM)
|
||||
setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA)
|
||||
setFeature(c, "hw.optional.arm.FEAT_FP", FP)
|
||||
setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP)
|
||||
setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA)
|
||||
setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT)
|
||||
setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC)
|
||||
setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL)
|
||||
setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1)
|
||||
setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2)
|
||||
setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3)
|
||||
setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512)
|
||||
// setFeature(c, "", SM3)
|
||||
// setFeature(c, "", SM4)
|
||||
setFeature(c, "hw.optional.arm.FEAT_SVE", SVE)
|
||||
|
||||
// from empirical observation
|
||||
setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP)
|
||||
setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS)
|
||||
setFeature(c, "hw.optional.floatingpoint", FP)
|
||||
setFeature(c, "hw.optional.armv8_2_sha3", SHA3)
|
||||
setFeature(c, "hw.optional.armv8_2_sha512", SHA512)
|
||||
setFeature(c, "hw.optional.armv8_3_compnum", FCMA)
|
||||
setFeature(c, "hw.optional.armv8_crc32", CRC32)
|
||||
}
|
||||
|
||||
33
vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go
generated
vendored
33
vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go
generated
vendored
@@ -11,7 +11,6 @@ import (
|
||||
"encoding/binary"
|
||||
"io/ioutil"
|
||||
"runtime"
|
||||
"unsafe"
|
||||
)
|
||||
|
||||
// HWCAP bits.
|
||||
@@ -42,12 +41,9 @@ const (
|
||||
hwcap_ASIMDFHM = 1 << 23
|
||||
)
|
||||
|
||||
//go:linkname hwcap internal/cpu.HWCap
|
||||
var hwcap uint
|
||||
|
||||
func detectOS(c *CPUInfo) bool {
|
||||
// For now assuming no hyperthreading is reasonable.
|
||||
c.LogicalCores = int(getproccount())
|
||||
c.LogicalCores = runtime.NumCPU()
|
||||
c.PhysicalCores = c.LogicalCores
|
||||
c.ThreadsPerCore = 1
|
||||
if hwcap == 0 {
|
||||
@@ -132,30 +128,3 @@ func detectOS(c *CPUInfo) bool {
|
||||
func isSet(hwc uint, value uint) bool {
|
||||
return hwc&value != 0
|
||||
}
|
||||
|
||||
//go:noescape
|
||||
//go:linkname sched_getaffinity runtime.sched_getaffinity
|
||||
func sched_getaffinity(pid, len uintptr, buf *byte) int32
|
||||
|
||||
func getproccount() int32 {
|
||||
// This buffer is huge (8 kB) but we are on the system stack
|
||||
// and there should be plenty of space (64 kB).
|
||||
// Also this is a leaf, so we're not holding up the memory for long.
|
||||
const maxCPUs = 64 * 1024
|
||||
var buf [maxCPUs / 8]byte
|
||||
r := sched_getaffinity(0, unsafe.Sizeof(buf), &buf[0])
|
||||
if r < 0 {
|
||||
return 0
|
||||
}
|
||||
n := int32(0)
|
||||
for _, v := range buf[:r] {
|
||||
for v != 0 {
|
||||
n += int32(v & 1)
|
||||
v >>= 1
|
||||
}
|
||||
}
|
||||
if n == 0 {
|
||||
n = 1
|
||||
}
|
||||
return n
|
||||
}
|
||||
|
||||
11
vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go
generated
vendored
11
vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go
generated
vendored
@@ -1,11 +1,16 @@
|
||||
// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
// +build arm64
|
||||
// +build !linux
|
||||
// +build !darwin
|
||||
//go:build arm64 && !linux && !darwin
|
||||
// +build arm64,!linux,!darwin
|
||||
|
||||
package cpuid
|
||||
|
||||
import "runtime"
|
||||
|
||||
func detectOS(c *CPUInfo) bool {
|
||||
c.PhysicalCores = runtime.NumCPU()
|
||||
// For now assuming 1 thread per core...
|
||||
c.ThreadsPerCore = 1
|
||||
c.LogicalCores = c.PhysicalCores
|
||||
return false
|
||||
}
|
||||
|
||||
8
vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go
generated
vendored
Normal file
8
vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go
generated
vendored
Normal file
@@ -0,0 +1,8 @@
|
||||
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//go:build nounsafe
|
||||
// +build nounsafe
|
||||
|
||||
package cpuid
|
||||
|
||||
var hwcap uint
|
||||
11
vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go
generated
vendored
Normal file
11
vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go
generated
vendored
Normal file
@@ -0,0 +1,11 @@
|
||||
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//go:build !nounsafe
|
||||
// +build !nounsafe
|
||||
|
||||
package cpuid
|
||||
|
||||
import _ "unsafe" // needed for go:linkname
|
||||
|
||||
//go:linkname hwcap internal/cpu.HWCap
|
||||
var hwcap uint
|
||||
8
vendor/github.com/klauspost/cpuid/v2/test-architectures.sh
generated
vendored
8
vendor/github.com/klauspost/cpuid/v2/test-architectures.sh
generated
vendored
@@ -5,11 +5,11 @@ set -e
|
||||
go tool dist list | while IFS=/ read os arch; do
|
||||
echo "Checking $os/$arch..."
|
||||
echo " normal"
|
||||
GOARCH=$arch GOOS=$os go build -o /dev/null ./...
|
||||
GOARCH=$arch GOOS=$os go build -o /dev/null .
|
||||
echo " noasm"
|
||||
GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null ./...
|
||||
GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null .
|
||||
echo " appengine"
|
||||
GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null ./...
|
||||
GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null .
|
||||
echo " noasm,appengine"
|
||||
GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null ./...
|
||||
GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null .
|
||||
done
|
||||
|
||||
Reference in New Issue
Block a user