go.mod: github.com/minio/sha256-simd v1.0.1

https://github.com/minio/sha256-simd/compare/v1.0.0...v1.0.1

Signed-off-by: Akihiro Suda <akihiro.suda.cz@hco.ntt.co.jp>
This commit is contained in:
Akihiro Suda
2023-07-23 02:48:30 +09:00
parent 1f2216cc78
commit 68abb525a5
30 changed files with 1429 additions and 330 deletions

4
go.mod
View File

@@ -37,7 +37,7 @@ require (
github.com/hashicorp/go-multierror v1.1.1
github.com/intel/goresctrl v0.3.0
github.com/klauspost/compress v1.16.7
github.com/minio/sha256-simd v1.0.0
github.com/minio/sha256-simd v1.0.1
github.com/moby/locker v1.0.1
github.com/moby/sys/mountinfo v0.6.2
github.com/moby/sys/sequential v0.5.0
@@ -102,7 +102,7 @@ require (
github.com/grpc-ecosystem/grpc-gateway/v2 v2.7.0 // indirect
github.com/hashicorp/errwrap v1.1.0 // indirect
github.com/json-iterator/go v1.1.12 // indirect
github.com/klauspost/cpuid/v2 v2.0.4 // indirect
github.com/klauspost/cpuid/v2 v2.2.5 // indirect
github.com/matttproud/golang_protobuf_extensions v1.0.4 // indirect
github.com/miekg/pkcs11 v1.1.1 // indirect
github.com/mistifyio/go-zfs/v3 v3.0.1 // indirect

9
go.sum
View File

@@ -648,8 +648,8 @@ github.com/klauspost/compress v1.11.3/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYs
github.com/klauspost/compress v1.11.13/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs=
github.com/klauspost/compress v1.16.7 h1:2mk3MPGNzKyxErAw8YaohYh69+pa4sIQSC0fPGCFR9I=
github.com/klauspost/compress v1.16.7/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE=
github.com/klauspost/cpuid/v2 v2.0.4 h1:g0I61F2K2DjRHz1cnxlkNSBIaePVoJIjjnHui8QHbiw=
github.com/klauspost/cpuid/v2 v2.0.4/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg=
github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
github.com/konsorten/go-windows-terminal-sequences v1.0.2/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
github.com/konsorten/go-windows-terminal-sequences v1.0.3/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
@@ -689,8 +689,8 @@ github.com/miekg/dns v1.0.14/go.mod h1:W1PPwlIAgtquWBMBEV9nkV9Cazfe8ScdGz/Lj7v3N
github.com/miekg/pkcs11 v1.0.3/go.mod h1:XsNlhZGX73bx86s2hdc/FuaLm2CPZJemRLMA+WTFxgs=
github.com/miekg/pkcs11 v1.1.1 h1:Ugu9pdy6vAYku5DEpVWVFPYnzV+bxB+iRdbuFSu7TvU=
github.com/miekg/pkcs11 v1.1.1/go.mod h1:XsNlhZGX73bx86s2hdc/FuaLm2CPZJemRLMA+WTFxgs=
github.com/minio/sha256-simd v1.0.0 h1:v1ta+49hkWZyvaKwrQB8elexRqm6Y0aMLjCNsrYxo6g=
github.com/minio/sha256-simd v1.0.0/go.mod h1:OuYzVNI5vcoYIAmbIvHPl3N3jUzVedXbKy5RFepssQM=
github.com/minio/sha256-simd v1.0.1 h1:6kaan5IFmwTNynnKKpDHe6FWHohJOHhCPchzK49dzMM=
github.com/minio/sha256-simd v1.0.1/go.mod h1:Pz6AKMiUdngCLpeTL/RJY1M9rUuPMYujV5xJjtbRSN8=
github.com/mistifyio/go-zfs v2.1.2-0.20190413222219-f784269be439+incompatible/go.mod h1:8AuVvqP/mXw1px98n46wfvcGfQ4ci2FwoAjKYxuo3Z4=
github.com/mistifyio/go-zfs/v3 v3.0.1 h1:YaoXgBePoMA12+S1u/ddkv+QqxcfiZK4prI6HPnkFiU=
github.com/mistifyio/go-zfs/v3 v3.0.1/go.mod h1:CzVgeB0RvF2EGzQnytKVvVSDwmKJXxkOTUGbNrTja/k=
@@ -1324,6 +1324,7 @@ golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBc
golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.2.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.10.0 h1:SqMFp9UcQJZa+pmYuAKjd9xq1f0j5rLcDIk0mj4qAsA=
golang.org/x/sys v0.10.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/term v0.0.0-20201117132131-f5c789dd3221/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw=

View File

@@ -1285,8 +1285,9 @@ github.com/klauspost/compress v1.16.0/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQs
github.com/klauspost/compress v1.16.5/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE=
github.com/klauspost/compress v1.16.7 h1:2mk3MPGNzKyxErAw8YaohYh69+pa4sIQSC0fPGCFR9I=
github.com/klauspost/compress v1.16.7/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE=
github.com/klauspost/cpuid/v2 v2.0.4/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
github.com/klauspost/cpuid/v2 v2.2.3/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY=
github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
github.com/konsorten/go-windows-terminal-sequences v1.0.2/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
github.com/konsorten/go-windows-terminal-sequences v1.0.3/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
@@ -1341,7 +1342,7 @@ github.com/miekg/dns v1.1.43/go.mod h1:+evo5L0630/F6ca/Z9+GAqzhjGyn8/c+TBaOyfEl0
github.com/miekg/pkcs11 v1.1.1/go.mod h1:XsNlhZGX73bx86s2hdc/FuaLm2CPZJemRLMA+WTFxgs=
github.com/minio/asm2plan9s v0.0.0-20200509001527-cdd76441f9d8/go.mod h1:mC1jAcsrzbxHt8iiaC+zU4b1ylILSosueou12R++wfY=
github.com/minio/c2goasm v0.0.0-20190812172519-36a3d3bbc4f3/go.mod h1:RagcQ7I8IeTMnF8JTXieKnO4Z6JCsikNEzj0DwauVzE=
github.com/minio/sha256-simd v1.0.0/go.mod h1:OuYzVNI5vcoYIAmbIvHPl3N3jUzVedXbKy5RFepssQM=
github.com/minio/sha256-simd v1.0.1/go.mod h1:Pz6AKMiUdngCLpeTL/RJY1M9rUuPMYujV5xJjtbRSN8=
github.com/mistifyio/go-zfs/v3 v3.0.1/go.mod h1:CzVgeB0RvF2EGzQnytKVvVSDwmKJXxkOTUGbNrTja/k=
github.com/mitchellh/cli v1.0.0/go.mod h1:hNIlj7HEI86fIcpObd7a0FcrxTWetlwJDGcceTlRvqc=
github.com/mitchellh/go-homedir v1.0.0/go.mod h1:SfyaCUpYCn1Vlf4IUYiD9fPX4A5wJrkLzIz1N1q0pr0=
@@ -2044,6 +2045,7 @@ golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBc
golang.org/x/sys v0.0.0-20220610221304-9f5ed59c137d/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220615213510-4f61da869c0c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220624220833-87e55d714810/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220704084225-05e143d24a9e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220728004956-3c1f35247d10/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=

74
vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml generated vendored Normal file
View File

@@ -0,0 +1,74 @@
# This is an example goreleaser.yaml file with some sane defaults.
# Make sure to check the documentation at http://goreleaser.com
builds:
-
id: "cpuid"
binary: cpuid
main: ./cmd/cpuid/main.go
env:
- CGO_ENABLED=0
flags:
- -ldflags=-s -w
goos:
- aix
- linux
- freebsd
- netbsd
- windows
- darwin
goarch:
- 386
- amd64
- arm64
goarm:
- 7
archives:
-
id: cpuid
name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}"
replacements:
aix: AIX
darwin: OSX
linux: Linux
windows: Windows
386: i386
amd64: x86_64
freebsd: FreeBSD
netbsd: NetBSD
format_overrides:
- goos: windows
format: zip
files:
- LICENSE
checksum:
name_template: 'checksums.txt'
snapshot:
name_template: "{{ .Tag }}-next"
changelog:
sort: asc
filters:
exclude:
- '^doc:'
- '^docs:'
- '^test:'
- '^tests:'
- '^Update\sREADME.md'
nfpms:
-
file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}"
vendor: Klaus Post
homepage: https://github.com/klauspost/cpuid
maintainer: Klaus Post <klauspost@gmail.com>
description: CPUID Tool
license: BSD 3-Clause
formats:
- deb
- rpm
replacements:
darwin: Darwin
linux: Linux
freebsd: FreeBSD
amd64: x86_64

View File

@@ -1,56 +0,0 @@
language: go
os:
- linux
- osx
- windows
arch:
- amd64
- arm64
go:
- 1.13.x
- 1.14.x
- 1.15.x
- 1.16.x
- master
script:
- go vet ./...
- go test -test.v -test.run ^TestCPUID$
- go test -race ./...
- go test -tags=noasm ./...
matrix:
allow_failures:
- go: 'master'
fast_finish: true
include:
- stage: gofmt
go: 1.15.x
os: linux
arch: amd64
script:
- diff <(gofmt -d .) <(printf "")
- diff <(gofmt -d ./private) <(printf "")
- go install github.com/klauspost/asmfmt/cmd/asmfmt
- diff <(asmfmt -d .) <(printf "")
- stage: i386
go: 1.15.x
os: linux
arch: amd64
script:
- GOOS=linux GOARCH=386 go test .
- stage: buildotherprev
go: 1.15.x
os: linux
arch: amd64
script:
- ./test-architectures.sh
- stage: buildother
go: 1.16.x
os: linux
arch: amd64
script:
- ./test-architectures.sh

View File

@@ -17,9 +17,22 @@ Package home: https://github.com/klauspost/cpuid
## installing
`go get -u github.com/klauspost/cpuid/v2` using modules.
Drop `v2` for others.
Installing binary:
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
Or download binaries from release page: https://github.com/klauspost/cpuid/releases
### Homebrew
For macOS/Linux users, you can install via [brew](https://brew.sh/)
```sh
$ brew install cpuid
```
## example
```Go
@@ -39,10 +52,10 @@ func main() {
fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore)
fmt.Println("LogicalCores:", CPU.LogicalCores)
fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID)
fmt.Println("Features:", fmt.Sprintf(strings.Join(CPU.FeatureSet(), ",")))
fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ","))
fmt.Println("Cacheline bytes:", CPU.CacheLine)
fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes")
fmt.Println("L1 Instruction Cache:", CPU.Cache.L1D, "bytes")
fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes")
fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes")
fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes")
fmt.Println("Frequency", CPU.Hz, "hz")
@@ -77,10 +90,14 @@ We have Streaming SIMD 2 Extensions
The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.
To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
Note that for some cpu/os combinations some features will not be detected.
`amd64` has rather good support and should work reliably on all platforms.
Note that hypervisors may not pass through all CPU features.
Note that hypervisors may not pass through all CPU features through to the guest OS,
so even if your host supports a feature it may not be visible on guests.
## arm64 feature detection
@@ -132,6 +149,345 @@ func main() {
}
```
## commandline
Download as binary from: https://github.com/klauspost/cpuid/releases
Install from source:
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
### Example
```
λ cpuid
Name: AMD Ryzen 9 3950X 16-Core Processor
Vendor String: AuthenticAMD
Vendor ID: AMD
PhysicalCores: 16
Threads Per Core: 2
Logical Cores: 32
CPU Family 23 Model: 113
Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE
Microarchitecture level: 3
Cacheline bytes: 64
L1 Instruction Cache: 32768 bytes
L1 Data Cache: 32768 bytes
L2 Cache: 524288 bytes
L3 Cache: 16777216 bytes
```
### JSON Output:
```
λ cpuid --json
{
"BrandName": "AMD Ryzen 9 3950X 16-Core Processor",
"VendorID": 2,
"VendorString": "AuthenticAMD",
"PhysicalCores": 16,
"ThreadsPerCore": 2,
"LogicalCores": 32,
"Family": 23,
"Model": 113,
"CacheLine": 64,
"Hz": 0,
"BoostFreq": 0,
"Cache": {
"L1I": 32768,
"L1D": 32768,
"L2": 524288,
"L3": 16777216
},
"SGX": {
"Available": false,
"LaunchControl": false,
"SGX1Supported": false,
"SGX2Supported": false,
"MaxEnclaveSizeNot64": 0,
"MaxEnclaveSize64": 0,
"EPCSections": null
},
"Features": [
"ADX",
"AESNI",
"AVX",
"AVX2",
"BMI1",
"BMI2",
"CLMUL",
"CLZERO",
"CMOV",
"CMPXCHG8",
"CPBOOST",
"CX16",
"F16C",
"FMA3",
"FXSR",
"FXSROPT",
"HTT",
"HYPERVISOR",
"LAHF",
"LZCNT",
"MCAOVERFLOW",
"MMX",
"MMXEXT",
"MOVBE",
"NX",
"OSXSAVE",
"POPCNT",
"RDRAND",
"RDSEED",
"RDTSCP",
"SCE",
"SHA",
"SSE",
"SSE2",
"SSE3",
"SSE4",
"SSE42",
"SSE4A",
"SSSE3",
"SUCCOR",
"X87",
"XSAVE"
],
"X64Level": 3
}
```
### Check CPU microarch level
```
λ cpuid --check-level=3
2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor
2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3.
Exit Code 0
λ cpuid --check-level=4
2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor
2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3.
Exit Code 1
```
## Available flags
### x86 & amd64
| Feature Flag | Description |
|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) |
| AESNI | Advanced Encryption Standard New Instructions |
| AMD3DNOW | AMD 3DNOW |
| AMD3DNOWEXT | AMD 3DNowExt |
| AMXBF16 | Tile computational operations on BFLOAT16 numbers |
| AMXINT8 | Tile computational operations on 8-bit integers |
| AMXFP16 | Tile computational operations on FP16 numbers |
| AMXTILE | Tile architecture |
| AVX | AVX functions |
| AVX2 | AVX2 functions |
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
| AVX512BITALG | AVX-512 Bit Algorithms |
| AVX512BW | AVX-512 Byte and Word Instructions |
| AVX512CD | AVX-512 Conflict Detection Instructions |
| AVX512DQ | AVX-512 Doubleword and Quadword Instructions |
| AVX512ER | AVX-512 Exponential and Reciprocal Instructions |
| AVX512F | AVX-512 Foundation |
| AVX512FP16 | AVX-512 FP16 Instructions |
| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions |
| AVX512PF | AVX-512 Prefetch Instructions |
| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions |
| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 |
| AVX512VL | AVX-512 Vector Length Extensions |
| AVX512VNNI | AVX-512 Vector Neural Network Instructions |
| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q |
| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword |
| AVXIFMA | AVX-IFMA instructions |
| AVXNECONVERT | AVX-NE-CONVERT instructions |
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
| BMI1 | Bit Manipulation Instruction Set 1 |
| BMI2 | Bit Manipulation Instruction Set 2 |
| CETIBT | Intel CET Indirect Branch Tracking |
| CETSS | Intel CET Shadow Stack |
| CLDEMOTE | Cache Line Demote |
| CLMUL | Carry-less Multiplication |
| CLZERO | CLZERO instruction supported |
| CMOV | i686 CMOV |
| CMPCCXADD | CMPCCXADD instructions |
| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB |
| CMPXCHG8 | CMPXCHG8 instruction |
| CPBOOST | Core Performance Boost |
| CPPC | AMD: Collaborative Processor Performance Control |
| CX16 | CMPXCHG16B Instruction |
| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ |
| ENQCMD | Enqueue Command |
| ERMS | Enhanced REP MOVSB/STOSB |
| F16C | Half-precision floating-point conversion |
| FLUSH_L1D | Flush L1D cache |
| FMA3 | Intel FMA 3. Does not imply AVX. |
| FMA4 | Bulldozer FMA4 functions |
| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide |
| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide |
| FSRM | Fast Short Rep Mov |
| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 |
| FXSROPT | FXSAVE/FXRSTOR optimizations |
| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. |
| HLE | Hardware Lock Elision |
| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR |
| HTT | Hyperthreading (enabled) |
| HWA | Hardware assert supported. Indicates support for MSRC001_10 |
| HYBRID_CPU | This part has CPUs of more than one type. |
| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors |
| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) |
| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR |
| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) |
| IBRS | AMD: Indirect Branch Restricted Speculation |
| IBRS_PREFERRED | AMD: IBRS is preferred over software solution |
| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection |
| IBS | Instruction Based Sampling (AMD) |
| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) |
| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) |
| IBSFFV | Instruction Based Sampling Feature (AMD) |
| IBSOPCNT | Instruction Based Sampling Feature (AMD) |
| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) |
| IBSOPSAM | Instruction Based Sampling Feature (AMD) |
| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) |
| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) |
| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported |
| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported |
| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
| IDPRED_CTRL | IPRED_DIS |
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
| LAHF | LAHF/SAHF in long mode |
| LAM | If set, CPU supports Linear Address Masking |
| LBRVIRT | LBR virtualization |
| LZCNT | LZCNT instruction |
| MCAOVERFLOW | MCA overflow recovery support. |
| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. |
| MCOMMIT | MCOMMIT instruction supported |
| MD_CLEAR | VERW clears CPU buffers |
| MMX | standard MMX |
| MMXEXT | SSE integer functions or AMD MMX ext |
| MOVBE | MOVBE instruction (big-endian) |
| MOVDIR64B | Move 64 Bytes as Direct Store |
| MOVDIRI | Move Doubleword as Direct Store |
| MOVSB_ZL | Fast Zero-Length MOVSB |
| MPX | Intel MPX (Memory Protection Extensions) |
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MSRIRC | Instruction Retired Counter MSR available |
| MSRLIST | Read/Write List of Model Specific Registers |
| MSR_PAGEFLUSH | Page Flush MSR available |
| NRIPS | Indicates support for NRIP save on VMEXIT |
| NX | NX (No-Execute) bit |
| OSXSAVE | XSAVE enabled by OS |
| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
| POPCNT | POPCNT instruction |
| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
| PREFETCHI | PREFETCHIT0/1 instructions |
| PSFD | Predictive Store Forward Disable |
| RDPRU | RDPRU instruction supported |
| RDRAND | RDRAND instruction is available |
| RDSEED | RDSEED instruction is available |
| RDTSCP | RDTSCP Instruction |
| RRSBA_CTRL | Restricted RSB Alternate |
| RTM | Restricted Transactional Memory |
| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
| SERIALIZE | Serialize Instruction Execution |
| SEV | AMD Secure Encrypted Virtualization supported |
| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host |
| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported |
| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests |
| SEV_ES | AMD SEV Encrypted State supported |
| SEV_RESTRICTED | AMD SEV Restricted Injection supported |
| SEV_SNP | AMD SEV Secure Nested Paging supported |
| SGX | Software Guard Extensions |
| SGXLC | Software Guard Extensions Launch Control |
| SHA | Intel SHA Extensions |
| SME | AMD Secure Memory Encryption supported |
| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced |
| SPEC_CTRL_SSBD | Speculative Store Bypass Disable |
| SRBDS_CTRL | SRBDS mitigation MSR available |
| SSE | SSE functions |
| SSE2 | P4 SSE functions |
| SSE3 | Prescott SSE3 functions |
| SSE4 | Penryn SSE4.1 functions |
| SSE42 | Nehalem SSE4.2 functions |
| SSE4A | AMD Barcelona microarchitecture SSE4a instructions |
| SSSE3 | Conroe SSSE3 functions |
| STIBP | Single Thread Indirect Branch Predictors |
| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On |
| STOSB_SHORT | Fast short STOSB |
| SUCCOR | Software uncorrectable error containment and recovery capability. |
| SVM | AMD Secure Virtual Machine |
| SVMDA | Indicates support for the SVM decode assists. |
| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
| SVML | AMD SVM lock. Indicates support for SVM-Lock. |
| SVMNP | AMD SVM nested paging |
| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter |
| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold |
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
| SYSEE | SYSENTER and SYSEXIT instructions |
| TBM | AMD Trailing Bit Manipulation |
| TDX_GUEST | Intel Trust Domain Extensions Guest |
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 |
| TSXLDTRK | Intel TSX Suspend Load Address Tracking |
| VAES | Vector AES. AVX(512) versions requires additional checks. |
| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. |
| VMPL | AMD VM Permission Levels supported |
| VMSA_REGPROT | AMD VMSA Register Protection supported |
| VMX | Virtual Machine Extensions |
| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. |
| VTE | AMD Virtual Transparent Encryption supported |
| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
| WBNOINVD | Write Back and Do Not Invalidate Cache |
| WRMSRNS | Non-Serializing Write to Model Specific Register |
| X87 | FPU |
| XGETBV1 | Supports XGETBV with ECX = 1 |
| XOP | Bulldozer XOP functions |
| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV |
| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. |
| XSAVEOPT | XSAVEOPT available |
| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS |
# ARM features:
| Feature Flag | Description |
|--------------|------------------------------------------------------------------|
| AESARM | AES instructions |
| ARMCPUID | Some CPU ID registers readable at user-level |
| ASIMD | Advanced SIMD |
| ASIMDDP | SIMD Dot Product |
| ASIMDHP | Advanced SIMD half-precision floating point |
| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
| ATOMICS | Large System Extensions (LSE) |
| CRC32 | CRC32/CRC32C instructions |
| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
| EVTSTRM | Generic timer |
| FCMA | Floatin point complex number addition and multiplication |
| FP | Single-precision and double-precision floating point |
| FPHP | Half-precision floating point |
| GPA | Generic Pointer Authentication |
| JSCVT | Javascript-style double->int convert (FJCVTZS) |
| LRCPC | Weaker release consistency (LDAPR, etc) |
| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
| SHA1 | SHA-1 instructions (SHA1C, etc) |
| SHA2 | SHA-2 instructions (SHA256H, etc) |
| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
| SHA512 | SHA512 instructions |
| SM3 | SM3 instructions |
| SM4 | SM4 instructions |
| SVE | Scalable Vector Extension |
# license
This code is published under an MIT license. See LICENSE file for more information.

View File

@@ -14,7 +14,9 @@ import (
"flag"
"fmt"
"math"
"math/bits"
"os"
"runtime"
"strings"
)
@@ -71,6 +73,7 @@ const (
AMD3DNOW // AMD 3DNOW
AMD3DNOWEXT // AMD 3DNowExt
AMXBF16 // Tile computational operations on BFLOAT16 numbers
AMXFP16 // Tile computational operations on FP16 numbers
AMXINT8 // Tile computational operations on 8-bit integers
AMXTILE // Tile architecture
AVX // AVX functions
@@ -82,6 +85,7 @@ const (
AVX512DQ // AVX-512 Doubleword and Quadword Instructions
AVX512ER // AVX-512 Exponential and Reciprocal Instructions
AVX512F // AVX-512 Foundation
AVX512FP16 // AVX-512 FP16 Instructions
AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions
AVX512PF // AVX-512 Prefetch Instructions
AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions
@@ -90,23 +94,51 @@ const (
AVX512VNNI // AVX-512 Vector Neural Network Instructions
AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one.
AVXIFMA // AVX-IFMA instructions
AVXNECONVERT // AVX-NE-CONVERT instructions
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
BMI1 // Bit Manipulation Instruction Set 1
BMI2 // Bit Manipulation Instruction Set 2
CETIBT // Intel CET Indirect Branch Tracking
CETSS // Intel CET Shadow Stack
CLDEMOTE // Cache Line Demote
CLMUL // Carry-less Multiplication
CLZERO // CLZERO instruction supported
CMOV // i686 CMOV
CMPCCXADD // CMPCCXADD instructions
CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
CMPXCHG8 // CMPXCHG8 instruction
CPBOOST // Core Performance Boost
CPPC // AMD: Collaborative Processor Performance Control
CX16 // CMPXCHG16B Instruction
EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
ENQCMD // Enqueue Command
ERMS // Enhanced REP MOVSB/STOSB
F16C // Half-precision floating-point conversion
FLUSH_L1D // Flush L1D cache
FMA3 // Intel FMA 3. Does not imply AVX.
FMA4 // Bulldozer FMA4 functions
GFNI // Galois Field New Instructions
FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
FSRM // Fast Short Rep Mov
FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
FXSROPT // FXSAVE/FXRSTOR optimizations
GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
HLE // Hardware Lock Elision
HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
HTT // Hyperthreading (enabled)
HWA // Hardware assert supported. Indicates support for MSRC001_10
HYBRID_CPU // This part has CPUs of more than one type.
HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors
IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
IBRS // AMD: Indirect Branch Restricted Speculation
IBRS_PREFERRED // AMD: IBRS is preferred over software solution
IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
IBS // Instruction Based Sampling (AMD)
IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
@@ -116,22 +148,63 @@ const (
IBSOPSAM // Instruction Based Sampling Feature (AMD)
IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
IBS_PREVENTHOST // Disallowing IBS use by the host supported
IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
IDPRED_CTRL // IPRED_DIS
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
INVLPGB // NVLPGB and TLBSYNC instruction supported
LAHF // LAHF/SAHF in long mode
LAM // If set, CPU supports Linear Address Masking
LBRVIRT // LBR virtualization
LZCNT // LZCNT instruction
MCAOVERFLOW // MCA overflow recovery support.
MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
MCOMMIT // MCOMMIT instruction supported
MD_CLEAR // VERW clears CPU buffers
MMX // standard MMX
MMXEXT // SSE integer functions or AMD MMX ext
MOVBE // MOVBE instruction (big-endian)
MOVDIR64B // Move 64 Bytes as Direct Store
MOVDIRI // Move Doubleword as Direct Store
MOVSB_ZL // Fast Zero-Length MOVSB
MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
MPX // Intel MPX (Memory Protection Extensions)
MSRIRC // Instruction Retired Counter MSR available
MSRLIST // Read/Write List of Model Specific Registers
MSR_PAGEFLUSH // Page Flush MSR available
NRIPS // Indicates support for NRIP save on VMEXIT
NX // NX (No-Execute) bit
OSXSAVE // XSAVE enabled by OS
PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
POPCNT // POPCNT instruction
PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
PREFETCHI // PREFETCHIT0/1 instructions
PSFD // Predictive Store Forward Disable
RDPRU // RDPRU instruction supported
RDRAND // RDRAND instruction is available
RDSEED // RDSEED instruction is available
RDTSCP // RDTSCP Instruction
RRSBA_CTRL // Restricted RSB Alternate
RTM // Restricted Transactional Memory
RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
SERIALIZE // Serialize Instruction Execution
SEV // AMD Secure Encrypted Virtualization supported
SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host
SEV_ALTERNATIVE // AMD SEV Alternate Injection supported
SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests
SEV_ES // AMD SEV Encrypted State supported
SEV_RESTRICTED // AMD SEV Restricted Injection supported
SEV_SNP // AMD SEV Secure Nested Paging supported
SGX // Software Guard Extensions
SGXLC // Software Guard Extensions Launch Control
SHA // Intel SHA Extensions
SME // AMD Secure Memory Encryption supported
SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced
SPEC_CTRL_SSBD // Speculative Store Bypass Disable
SRBDS_CTRL // SRBDS mitigation MSR available
SSE // SSE functions
SSE2 // P4 SSE functions
SSE3 // Prescott SSE3 functions
@@ -140,14 +213,42 @@ const (
SSE4A // AMD Barcelona microarchitecture SSE4a instructions
SSSE3 // Conroe SSSE3 functions
STIBP // Single Thread Indirect Branch Predictors
STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
STOSB_SHORT // Fast short STOSB
SUCCOR // Software uncorrectable error containment and recovery capability.
SVM // AMD Secure Virtual Machine
SVMDA // Indicates support for the SVM decode assists.
SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
SVML // AMD SVM lock. Indicates support for SVM-Lock.
SVMNP // AMD SVM nested paging
SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter
SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
SYSEE // SYSENTER and SYSEXIT instructions
TBM // AMD Trailing Bit Manipulation
TDX_GUEST // Intel Trust Domain Extensions Guest
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
TSXLDTRK // Intel TSX Suspend Load Address Tracking
VAES // Vector AES
VAES // Vector AES. AVX(512) versions requires additional checks.
VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits.
VMPL // AMD VM Permission Levels supported
VMSA_REGPROT // AMD VMSA Register Protection supported
VMX // Virtual Machine Extensions
VPCLMULQDQ // Carry-Less Multiplication Quadword
VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
VTE // AMD Virtual Transparent Encryption supported
WAITPKG // TPAUSE, UMONITOR, UMWAIT
WBNOINVD // Write Back and Do Not Invalidate Cache
WRMSRNS // Non-Serializing Write to Model Specific Register
X87 // FPU
XGETBV1 // Supports XGETBV with ECX = 1
XOP // Bulldozer XOP functions
XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV
XSAVEC // Supports XSAVEC and the compacted form of XRSTOR.
XSAVEOPT // XSAVEOPT available
XSAVES // Supports XSAVES/XRSTORS and IA32_XSS
// ARM features:
AESARM // AES instructions
@@ -174,7 +275,6 @@ const (
SM3 // SM3 instructions
SM4 // SM4 instructions
SVE // Scalable Vector Extension
// Keep it last. It automatically defines the size of []flagSet
lastID
@@ -192,8 +292,10 @@ type CPUInfo struct {
LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable.
Family int // CPU family number
Model int // CPU model number
Stepping int // CPU stepping info
CacheLine int // Cache line size in bytes. Will be 0 if undetectable.
Hz int64 // Clock speed, if known, 0 otherwise
Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed.
BoostFreq int64 // Max clock speed, if known, 0 otherwise
Cache struct {
L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected
L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected
@@ -209,6 +311,7 @@ var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32)
var xgetbv func(index uint32) (eax, edx uint32)
var rdtscpAsm func() (eax, ebx, ecx, edx uint32)
var darwinHasAVX512 = func() bool { return false }
// CPU contains information about the CPU as detected on startup,
// or when Detect last was called.
@@ -292,10 +395,66 @@ func (c CPUInfo) Supports(ids ...FeatureID) bool {
// Has allows for checking a single feature.
// Should be inlined by the compiler.
func (c CPUInfo) Has(id FeatureID) bool {
func (c *CPUInfo) Has(id FeatureID) bool {
return c.featureSet.inSet(id)
}
// AnyOf returns whether the CPU supports one or more of the requested features.
func (c CPUInfo) AnyOf(ids ...FeatureID) bool {
for _, id := range ids {
if c.featureSet.inSet(id) {
return true
}
}
return false
}
// Features contains several features combined for a fast check using
// CpuInfo.HasAll
type Features *flagSet
// CombineFeatures allows to combine several features for a close to constant time lookup.
func CombineFeatures(ids ...FeatureID) Features {
var v flagSet
for _, id := range ids {
v.set(id)
}
return &v
}
func (c *CPUInfo) HasAll(f Features) bool {
return c.featureSet.hasSetP(f)
}
// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
var oneOfLevel = CombineFeatures(SYSEE, SYSCALL)
var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2)
var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
// X64Level returns the microarchitecture level detected on the CPU.
// If features are lacking or non x64 mode, 0 is returned.
// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
func (c CPUInfo) X64Level() int {
if !c.featureSet.hasOneOf(oneOfLevel) {
return 0
}
if c.featureSet.hasSetP(level4Features) {
return 4
}
if c.featureSet.hasSetP(level3Features) {
return 3
}
if c.featureSet.hasSetP(level2Features) {
return 2
}
if c.featureSet.hasSetP(level1Features) {
return 1
}
return 0
}
// Disable will disable one or several features.
func (c *CPUInfo) Disable(ids ...FeatureID) bool {
for _, id := range ids {
@@ -318,11 +477,10 @@ func (c CPUInfo) IsVendor(v Vendor) bool {
return c.VendorID == v
}
// FeatureSet returns all available features as strings.
func (c CPUInfo) FeatureSet() []string {
s := make([]string, 0)
for _, f := range c.featureSet.Strings() {
s = append(s, f)
}
s := make([]string, 0, c.featureSet.nEnabled())
s = append(s, c.featureSet.Strings()...)
return s
}
@@ -361,25 +519,42 @@ func (c CPUInfo) LogicalCPU() int {
return int(ebx >> 24)
}
// hertz tries to compute the clock speed of the CPU. If leaf 15 is
// frequencies tries to compute the clock speed of the CPU. If leaf 15 is
// supported, use it, otherwise parse the brand string. Yes, really.
func hertz(model string) int64 {
func (c *CPUInfo) frequencies() {
c.Hz, c.BoostFreq = 0, 0
mfi := maxFunctionID()
if mfi >= 0x15 {
eax, ebx, ecx, _ := cpuid(0x15)
if eax != 0 && ebx != 0 && ecx != 0 {
return int64((int64(ecx) * int64(ebx)) / int64(eax))
c.Hz = (int64(ecx) * int64(ebx)) / int64(eax)
}
}
if mfi >= 0x16 {
a, b, _, _ := cpuid(0x16)
// Base...
if a&0xffff > 0 {
c.Hz = int64(a&0xffff) * 1_000_000
}
// Boost...
if b&0xffff > 0 {
c.BoostFreq = int64(b&0xffff) * 1_000_000
}
}
if c.Hz > 0 {
return
}
// computeHz determines the official rated speed of a CPU from its brand
// string. This insanity is *actually the official documented way to do
// this according to Intel*, prior to leaf 0x15 existing. The official
// documentation only shows this working for exactly `x.xx` or `xxxx`
// cases, e.g., `2.50GHz` or `1300MHz`; this parser will accept other
// sizes.
model := c.BrandName
hz := strings.LastIndex(model, "Hz")
if hz < 3 {
return 0
return
}
var multiplier int64
switch model[hz-1] {
@@ -391,7 +566,7 @@ func hertz(model string) int64 {
multiplier = 1000 * 1000 * 1000 * 1000
}
if multiplier == 0 {
return 0
return
}
freq := int64(0)
divisor := int64(0)
@@ -403,21 +578,22 @@ func hertz(model string) int64 {
decimalShift *= 10
} else if model[i] == '.' {
if divisor != 0 {
return 0
return
}
divisor = decimalShift
} else {
return 0
return
}
}
// we didn't find a space
if i < 0 {
return 0
return
}
if divisor != 0 {
return (freq * multiplier) / divisor
c.Hz = (freq * multiplier) / divisor
return
}
return freq * multiplier
c.Hz = freq * multiplier
}
// VM Will return true if the cpu id indicates we are in
@@ -437,7 +613,7 @@ const flagMask = flagBits - 1
// flagSet contains detected cpu features and characteristics in an array of flags
type flagSet [(lastID + flagMask) / flagBits]flags
func (s flagSet) inSet(feat FeatureID) bool {
func (s *flagSet) inSet(feat FeatureID) bool {
return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0
}
@@ -466,6 +642,52 @@ func (s *flagSet) or(other flagSet) {
}
}
// hasSet returns whether all features are present.
func (s *flagSet) hasSet(other flagSet) bool {
for i, v := range other[:] {
if s[i]&v != v {
return false
}
}
return true
}
// hasSet returns whether all features are present.
func (s *flagSet) hasSetP(other *flagSet) bool {
for i, v := range other[:] {
if s[i]&v != v {
return false
}
}
return true
}
// hasOneOf returns whether one or more features are present.
func (s *flagSet) hasOneOf(other *flagSet) bool {
for i, v := range other[:] {
if s[i]&v != 0 {
return true
}
}
return false
}
// nEnabled will return the number of enabled flags.
func (s *flagSet) nEnabled() (n int) {
for _, v := range s[:] {
n += bits.OnesCount64(uint64(v))
}
return n
}
func flagSetWith(feat ...FeatureID) flagSet {
var res flagSet
for _, f := range feat {
res.set(f)
}
return res
}
// ParseFeature will parse the string and return the ID of the matching feature.
// Will return UNKNOWN if not found.
func ParseFeature(s string) FeatureID {
@@ -546,7 +768,7 @@ func threadsPerCore() int {
if vend == AMD {
// Workaround for AMD returning 0, assume 2 if >= Zen 2
// It will be more correct than not.
fam, _ := familyModel()
fam, _, _ := familyModel()
_, _, _, d := cpuid(1)
if (d&(1<<28)) != 0 && fam >= 23 {
return 2
@@ -584,14 +806,27 @@ func logicalCores() int {
}
}
func familyModel() (int, int) {
func familyModel() (family, model, stepping int) {
if maxFunctionID() < 0x1 {
return 0, 0
return 0, 0, 0
}
eax, _, _, _ := cpuid(1)
family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff)
model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0)
return int(family), int(model)
// If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0].
family = int((eax >> 8) & 0xf)
extFam := family == 0x6 // Intel is 0x6, needs extended model.
if family == 0xf {
// Add ExtFamily
family += int((eax >> 20) & 0xff)
extFam = true
}
// If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0].
model = int((eax >> 4) & 0xf)
if extFam {
// Add ExtModel
model += int((eax >> 12) & 0xf0)
}
stepping = int(eax & 0xf)
return family, model, stepping
}
func physicalCores() int {
@@ -675,6 +910,7 @@ func (c *CPUInfo) cacheSize() {
if maxFunctionID() < 4 {
return
}
c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0
for i := uint32(0); ; i++ {
eax, ebx, ecx, _ := cpuidex(4, i)
cacheType := eax & 15
@@ -725,9 +961,14 @@ func (c *CPUInfo) cacheSize() {
c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024)
// CPUID Fn8000_001D_EAX_x[N:0] Cache Properties
if maxExtendedFunction() < 0x8000001D {
if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) {
return
}
// Xen Hypervisor is buggy and returns the same entry no matter ECX value.
// Hack: When we encounter the same entry 100 times we break.
nSame := 0
var last uint32
for i := uint32(0); i < math.MaxUint32; i++ {
eax, ebx, ecx, _ := cpuidex(0x8000001D, i)
@@ -743,6 +984,16 @@ func (c *CPUInfo) cacheSize() {
return
}
// Check for the same value repeated.
comb := eax ^ ebx ^ ecx
if comb == last {
nSame++
if nSame == 100 {
return
}
}
last = comb
switch level {
case 1:
switch typ {
@@ -767,8 +1018,6 @@ func (c *CPUInfo) cacheSize() {
}
}
}
return
}
type SGXEPCSection struct {
@@ -829,21 +1078,26 @@ func support() flagSet {
if mfi < 0x1 {
return fs
}
family, model := familyModel()
family, model, _ := familyModel()
_, _, c, d := cpuid(1)
fs.setIf((d&(1<<0)) != 0, X87)
fs.setIf((d&(1<<8)) != 0, CMPXCHG8)
fs.setIf((d&(1<<11)) != 0, SYSEE)
fs.setIf((d&(1<<15)) != 0, CMOV)
fs.setIf((d&(1<<23)) != 0, MMX)
fs.setIf((d&(1<<25)) != 0, MMXEXT)
fs.setIf((d&(1<<24)) != 0, FXSR)
fs.setIf((d&(1<<25)) != 0, FXSROPT)
fs.setIf((d&(1<<25)) != 0, SSE)
fs.setIf((d&(1<<26)) != 0, SSE2)
fs.setIf((c&1) != 0, SSE3)
fs.setIf((c&(1<<5)) != 0, VMX)
fs.setIf((c&0x00000200) != 0, SSSE3)
fs.setIf((c&0x00080000) != 0, SSE4)
fs.setIf((c&0x00100000) != 0, SSE42)
fs.setIf((c&(1<<9)) != 0, SSSE3)
fs.setIf((c&(1<<19)) != 0, SSE4)
fs.setIf((c&(1<<20)) != 0, SSE42)
fs.setIf((c&(1<<25)) != 0, AESNI)
fs.setIf((c&(1<<1)) != 0, CLMUL)
fs.setIf(c&(1<<22) != 0, MOVBE)
fs.setIf(c&(1<<23) != 0, POPCNT)
fs.setIf(c&(1<<30) != 0, RDRAND)
@@ -859,6 +1113,8 @@ func support() flagSet {
if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 {
fs.setIf(threadsPerCore() > 1, HTT)
}
fs.setIf(c&1<<26 != 0, XSAVE)
fs.setIf(c&1<<27 != 0, OSXSAVE)
// Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits
const avxCheck = 1<<26 | 1<<27 | 1<<28
if c&avxCheck == avxCheck {
@@ -884,7 +1140,6 @@ func support() flagSet {
// Check AVX2, AVX2 requires OS support, but BMI1/2 don't.
if mfi >= 7 {
_, ebx, ecx, edx := cpuidex(7, 0)
eax1, _, _, _ := cpuidex(7, 1)
if fs.inSet(AVX) && (ebx&0x00000020) != 0 {
fs.set(AVX2)
}
@@ -901,18 +1156,52 @@ func support() flagSet {
fs.setIf(ebx&(1<<18) != 0, RDSEED)
fs.setIf(ebx&(1<<19) != 0, ADX)
fs.setIf(ebx&(1<<29) != 0, SHA)
// CPUID.(EAX=7, ECX=0).ECX
fs.setIf(ecx&(1<<5) != 0, WAITPKG)
fs.setIf(ecx&(1<<7) != 0, CETSS)
fs.setIf(ecx&(1<<8) != 0, GFNI)
fs.setIf(ecx&(1<<9) != 0, VAES)
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
fs.setIf(ecx&(1<<13) != 0, TME)
fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
fs.setIf(ecx&(1<<29) != 0, ENQCMD)
fs.setIf(ecx&(1<<30) != 0, SGXLC)
// CPUID.(EAX=7, ECX=0).EDX
fs.setIf(edx&(1<<4) != 0, FSRM)
fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL)
fs.setIf(edx&(1<<10) != 0, MD_CLEAR)
fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT)
fs.setIf(edx&(1<<14) != 0, SERIALIZE)
fs.setIf(edx&(1<<15) != 0, HYBRID_CPU)
fs.setIf(edx&(1<<16) != 0, TSXLDTRK)
fs.setIf(edx&(1<<18) != 0, PCONFIG)
fs.setIf(edx&(1<<20) != 0, CETIBT)
fs.setIf(edx&(1<<26) != 0, IBPB)
fs.setIf(edx&(1<<27) != 0, STIBP)
fs.setIf(edx&(1<<28) != 0, FLUSH_L1D)
fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP)
fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
// CPUID.(EAX=7, ECX=1).EAX
eax1, _, _, edx1 := cpuidex(7, 1)
fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT)
fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT)
fs.setIf(eax1&(1<<22) != 0, HRESET)
fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
fs.setIf(eax1&(1<<26) != 0, LAM)
// CPUID.(EAX=7, ECX=1).EDX
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
// Only detect AVX-512 features if XGETBV is supported
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
@@ -922,7 +1211,11 @@ func support() flagSet {
// Verify that XCR0[7:5] = 111b (OPMASK state, upper 256-bit of ZMM0-ZMM15 and
// ZMM16-ZMM31 state are enabled by OS)
/// and that XCR0[2:1] = 11b (XMM state and YMM state are enabled by OS).
if (eax>>5)&7 == 7 && (eax>>1)&3 == 3 {
hasAVX512 := (eax>>5)&7 == 7 && (eax>>1)&3 == 3
if runtime.GOOS == "darwin" {
hasAVX512 = fs.inSet(AVX) && darwinHasAVX512()
}
if hasAVX512 {
fs.setIf(ebx&(1<<16) != 0, AVX512F)
fs.setIf(ebx&(1<<17) != 0, AVX512DQ)
fs.setIf(ebx&(1<<21) != 0, AVX512IFMA)
@@ -934,49 +1227,137 @@ func support() flagSet {
// ecx
fs.setIf(ecx&(1<<1) != 0, AVX512VBMI)
fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2)
fs.setIf(ecx&(1<<8) != 0, GFNI)
fs.setIf(ecx&(1<<9) != 0, VAES)
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
fs.setIf(ecx&(1<<11) != 0, AVX512VNNI)
fs.setIf(ecx&(1<<12) != 0, AVX512BITALG)
fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ)
// edx
fs.setIf(edx&(1<<8) != 0, AVX512VP2INTERSECT)
fs.setIf(edx&(1<<22) != 0, AMXBF16)
fs.setIf(edx&(1<<23) != 0, AVX512FP16)
fs.setIf(edx&(1<<24) != 0, AMXTILE)
fs.setIf(edx&(1<<25) != 0, AMXINT8)
// eax1 = CPUID.(EAX=7, ECX=1).EAX
fs.setIf(eax1&(1<<5) != 0, AVX512BF16)
}
fs.setIf(eax1&(1<<19) != 0, WRMSRNS)
fs.setIf(eax1&(1<<21) != 0, AMXFP16)
fs.setIf(eax1&(1<<27) != 0, MSRLIST)
}
}
// CPUID.(EAX=7, ECX=2)
_, _, _, edx = cpuidex(7, 2)
fs.setIf(edx&(1<<0) != 0, PSFD)
fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL)
fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL)
fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
fs.setIf(edx&(1<<5) != 0, MCDT_NO)
}
// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
// EAX
// Bit 00: XSAVEOPT is available.
// Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set.
// Bit 02: Supports XGETBV with ECX = 1 if set.
// Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set.
// Bits 31 - 04: Reserved.
// EBX
// Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS.
// ECX
// Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1.
// EDX?
// Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved.
if mfi >= 0xd {
if fs.inSet(XSAVE) {
eax, _, _, _ := cpuidex(0xd, 1)
fs.setIf(eax&(1<<0) != 0, XSAVEOPT)
fs.setIf(eax&(1<<1) != 0, XSAVEC)
fs.setIf(eax&(1<<2) != 0, XGETBV1)
fs.setIf(eax&(1<<3) != 0, XSAVES)
}
}
if maxExtendedFunction() >= 0x80000001 {
_, _, c, d := cpuid(0x80000001)
if (c & (1 << 5)) != 0 {
fs.set(LZCNT)
fs.set(POPCNT)
}
fs.setIf((c&(1<<10)) != 0, IBS)
fs.setIf((d&(1<<31)) != 0, AMD3DNOW)
fs.setIf((d&(1<<30)) != 0, AMD3DNOWEXT)
fs.setIf((d&(1<<23)) != 0, MMX)
fs.setIf((d&(1<<22)) != 0, MMXEXT)
// ECX
fs.setIf((c&(1<<0)) != 0, LAHF)
fs.setIf((c&(1<<2)) != 0, SVM)
fs.setIf((c&(1<<6)) != 0, SSE4A)
fs.setIf((c&(1<<10)) != 0, IBS)
fs.setIf((c&(1<<22)) != 0, TOPEXT)
// EDX
fs.setIf(d&(1<<11) != 0, SYSCALL)
fs.setIf(d&(1<<20) != 0, NX)
fs.setIf(d&(1<<22) != 0, MMXEXT)
fs.setIf(d&(1<<23) != 0, MMX)
fs.setIf(d&(1<<24) != 0, FXSR)
fs.setIf(d&(1<<25) != 0, FXSROPT)
fs.setIf(d&(1<<27) != 0, RDTSCP)
fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT)
fs.setIf(d&(1<<31) != 0, AMD3DNOW)
/* XOP and FMA4 use the AVX instruction coding scheme, so they can't be
* used unless the OS has AVX support. */
if fs.inSet(AVX) {
fs.setIf((c&0x00000800) != 0, XOP)
fs.setIf((c&0x00010000) != 0, FMA4)
fs.setIf((c&(1<<11)) != 0, XOP)
fs.setIf((c&(1<<16)) != 0, FMA4)
}
}
if maxExtendedFunction() >= 0x80000007 {
_, b, _, d := cpuid(0x80000007)
fs.setIf((b&(1<<0)) != 0, MCAOVERFLOW)
fs.setIf((b&(1<<1)) != 0, SUCCOR)
fs.setIf((b&(1<<2)) != 0, HWA)
fs.setIf((d&(1<<9)) != 0, CPBOOST)
}
if maxExtendedFunction() >= 0x80000008 {
_, b, _, _ := cpuid(0x80000008)
fs.setIf(b&(1<<28) != 0, PSFD)
fs.setIf(b&(1<<27) != 0, CPPC)
fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD)
fs.setIf(b&(1<<23) != 0, PPIN)
fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED)
fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS)
fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP)
fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED)
fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON)
fs.setIf(b&(1<<15) != 0, STIBP)
fs.setIf(b&(1<<14) != 0, IBRS)
fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
fs.setIf(b&(1<<12) != 0, IBPB)
fs.setIf((b&(1<<9)) != 0, WBNOINVD)
fs.setIf((b&(1<<8)) != 0, MCOMMIT)
fs.setIf((b&(1<<4)) != 0, RDPRU)
fs.setIf((b&(1<<3)) != 0, INVLPGB)
fs.setIf((b&(1<<1)) != 0, MSRIRC)
fs.setIf((b&(1<<0)) != 0, CLZERO)
}
if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A {
_, _, _, edx := cpuid(0x8000000A)
fs.setIf((edx>>0)&1 == 1, SVMNP)
fs.setIf((edx>>1)&1 == 1, LBRVIRT)
fs.setIf((edx>>2)&1 == 1, SVML)
fs.setIf((edx>>3)&1 == 1, NRIPS)
fs.setIf((edx>>4)&1 == 1, TSCRATEMSR)
fs.setIf((edx>>5)&1 == 1, VMCBCLEAN)
fs.setIf((edx>>6)&1 == 1, SVMFBASID)
fs.setIf((edx>>7)&1 == 1, SVMDA)
fs.setIf((edx>>10)&1 == 1, SVMPF)
fs.setIf((edx>>12)&1 == 1, SVMPFT)
}
if maxExtendedFunction() >= 0x8000001a {
eax, _, _, _ := cpuid(0x8000001a)
fs.setIf((eax>>0)&1 == 1, FP128)
fs.setIf((eax>>1)&1 == 1, MOVU)
fs.setIf((eax>>2)&1 == 1, FP256)
}
if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) {
@@ -989,6 +1370,35 @@ func support() flagSet {
fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT)
fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT)
fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK)
fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE)
fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX)
fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1.
fs.setIf((eax>>11)&1 == 1, IBS_ZEN4)
}
if maxExtendedFunction() >= 0x8000001f && vend == AMD {
a, _, _, _ := cpuid(0x8000001f)
fs.setIf((a>>0)&1 == 1, SME)
fs.setIf((a>>1)&1 == 1, SEV)
fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH)
fs.setIf((a>>3)&1 == 1, SEV_ES)
fs.setIf((a>>4)&1 == 1, SEV_SNP)
fs.setIf((a>>5)&1 == 1, VMPL)
fs.setIf((a>>10)&1 == 1, SME_COHERENT)
fs.setIf((a>>11)&1 == 1, SEV_64BIT)
fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED)
fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE)
fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP)
fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST)
fs.setIf((a>>16)&1 == 1, VTE)
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
}
if mfi >= 0x21 {
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
_, ebx, ecx, edx := cpuid(0x21)
identity := string(valAsString(ebx, edx, ecx))
fs.setIf(identity == "IntelTDX ", TDX_GUEST)
}
return fs

View File

@@ -40,3 +40,8 @@ TEXT ·asmRdtscpAsm(SB), 7, $0
MOVL CX, ecx+8(FP)
MOVL DX, edx+12(FP)
RET
// func asmDarwinHasAVX512() bool
TEXT ·asmDarwinHasAVX512(SB), 7, $0
MOVL $0, eax+0(FP)
RET

View File

@@ -40,3 +40,33 @@ TEXT ·asmRdtscpAsm(SB), 7, $0
MOVL CX, ecx+8(FP)
MOVL DX, edx+12(FP)
RET
// From https://go-review.googlesource.com/c/sys/+/285572/
// func asmDarwinHasAVX512() bool
TEXT ·asmDarwinHasAVX512(SB), 7, $0-1
MOVB $0, ret+0(FP) // default to false
#ifdef GOOS_darwin // return if not darwin
#ifdef GOARCH_amd64 // return if not amd64
// These values from:
// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h
#define commpage64_base_address 0x00007fffffe00000
#define commpage64_cpu_capabilities64 (commpage64_base_address+0x010)
#define commpage64_version (commpage64_base_address+0x01E)
#define hasAVX512F 0x0000004000000000
MOVQ $commpage64_version, BX
MOVW (BX), AX
CMPW AX, $13 // versions < 13 do not support AVX512
JL no_avx512
MOVQ $commpage64_cpu_capabilities64, BX
MOVQ (BX), AX
MOVQ $hasAVX512F, CX
ANDQ CX, AX
JZ no_avx512
MOVB $1, ret+0(FP)
no_avx512:
#endif
#endif
RET

View File

@@ -1,6 +1,7 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
//+build arm64,!gccgo,!noasm,!appengine
//go:build arm64 && !gccgo && !noasm && !appengine
// +build arm64,!gccgo,!noasm,!appengine
package cpuid

View File

@@ -1,6 +1,7 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
//+build !amd64,!386,!arm64 gccgo noasm appengine
//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine
// +build !amd64,!386,!arm64 gccgo noasm appengine
package cpuid

View File

@@ -1,6 +1,7 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
//+build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine)
// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
package cpuid
@@ -8,12 +9,14 @@ func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
func asmXgetbv(index uint32) (eax, edx uint32)
func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
func asmDarwinHasAVX512() bool
func initCPU() {
cpuid = asmCpuid
cpuidex = asmCpuidex
xgetbv = asmXgetbv
rdtscpAsm = asmRdtscpAsm
darwinHasAVX512 = asmDarwinHasAVX512
}
func addInfo(c *CPUInfo, safe bool) {
@@ -21,13 +24,13 @@ func addInfo(c *CPUInfo, safe bool) {
c.maxExFunc = maxExtendedFunction()
c.BrandName = brandName()
c.CacheLine = cacheLine()
c.Family, c.Model = familyModel()
c.Family, c.Model, c.Stepping = familyModel()
c.featureSet = support()
c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
c.ThreadsPerCore = threadsPerCore()
c.LogicalCores = logicalCores()
c.PhysicalCores = physicalCores()
c.VendorID, c.VendorString = vendorID()
c.Hz = hertz(c.BrandName)
c.cacheSize()
c.frequencies()
}

View File

@@ -13,114 +13,213 @@ func _() {
_ = x[AMD3DNOW-3]
_ = x[AMD3DNOWEXT-4]
_ = x[AMXBF16-5]
_ = x[AMXINT8-6]
_ = x[AMXTILE-7]
_ = x[AVX-8]
_ = x[AVX2-9]
_ = x[AVX512BF16-10]
_ = x[AVX512BITALG-11]
_ = x[AVX512BW-12]
_ = x[AVX512CD-13]
_ = x[AVX512DQ-14]
_ = x[AVX512ER-15]
_ = x[AVX512F-16]
_ = x[AVX512IFMA-17]
_ = x[AVX512PF-18]
_ = x[AVX512VBMI-19]
_ = x[AVX512VBMI2-20]
_ = x[AVX512VL-21]
_ = x[AVX512VNNI-22]
_ = x[AVX512VP2INTERSECT-23]
_ = x[AVX512VPOPCNTDQ-24]
_ = x[AVXSLOW-25]
_ = x[BMI1-26]
_ = x[BMI2-27]
_ = x[CLDEMOTE-28]
_ = x[CLMUL-29]
_ = x[CMOV-30]
_ = x[CX16-31]
_ = x[ENQCMD-32]
_ = x[ERMS-33]
_ = x[F16C-34]
_ = x[FMA3-35]
_ = x[FMA4-36]
_ = x[GFNI-37]
_ = x[HLE-38]
_ = x[HTT-39]
_ = x[HYPERVISOR-40]
_ = x[IBPB-41]
_ = x[IBS-42]
_ = x[IBSBRNTRGT-43]
_ = x[IBSFETCHSAM-44]
_ = x[IBSFFV-45]
_ = x[IBSOPCNT-46]
_ = x[IBSOPCNTEXT-47]
_ = x[IBSOPSAM-48]
_ = x[IBSRDWROPCNT-49]
_ = x[IBSRIPINVALIDCHK-50]
_ = x[LZCNT-51]
_ = x[MMX-52]
_ = x[MMXEXT-53]
_ = x[MOVDIR64B-54]
_ = x[MOVDIRI-55]
_ = x[MPX-56]
_ = x[NX-57]
_ = x[POPCNT-58]
_ = x[RDRAND-59]
_ = x[RDSEED-60]
_ = x[RDTSCP-61]
_ = x[RTM-62]
_ = x[SERIALIZE-63]
_ = x[SGX-64]
_ = x[SGXLC-65]
_ = x[SHA-66]
_ = x[SSE-67]
_ = x[SSE2-68]
_ = x[SSE3-69]
_ = x[SSE4-70]
_ = x[SSE42-71]
_ = x[SSE4A-72]
_ = x[SSSE3-73]
_ = x[STIBP-74]
_ = x[TBM-75]
_ = x[TSXLDTRK-76]
_ = x[VAES-77]
_ = x[VMX-78]
_ = x[VPCLMULQDQ-79]
_ = x[WAITPKG-80]
_ = x[WBNOINVD-81]
_ = x[XOP-82]
_ = x[AESARM-83]
_ = x[ARMCPUID-84]
_ = x[ASIMD-85]
_ = x[ASIMDDP-86]
_ = x[ASIMDHP-87]
_ = x[ASIMDRDM-88]
_ = x[ATOMICS-89]
_ = x[CRC32-90]
_ = x[DCPOP-91]
_ = x[EVTSTRM-92]
_ = x[FCMA-93]
_ = x[FP-94]
_ = x[FPHP-95]
_ = x[GPA-96]
_ = x[JSCVT-97]
_ = x[LRCPC-98]
_ = x[PMULL-99]
_ = x[SHA1-100]
_ = x[SHA2-101]
_ = x[SHA3-102]
_ = x[SHA512-103]
_ = x[SM3-104]
_ = x[SM4-105]
_ = x[SVE-106]
_ = x[lastID-107]
_ = x[AMXFP16-6]
_ = x[AMXINT8-7]
_ = x[AMXTILE-8]
_ = x[AVX-9]
_ = x[AVX2-10]
_ = x[AVX512BF16-11]
_ = x[AVX512BITALG-12]
_ = x[AVX512BW-13]
_ = x[AVX512CD-14]
_ = x[AVX512DQ-15]
_ = x[AVX512ER-16]
_ = x[AVX512F-17]
_ = x[AVX512FP16-18]
_ = x[AVX512IFMA-19]
_ = x[AVX512PF-20]
_ = x[AVX512VBMI-21]
_ = x[AVX512VBMI2-22]
_ = x[AVX512VL-23]
_ = x[AVX512VNNI-24]
_ = x[AVX512VP2INTERSECT-25]
_ = x[AVX512VPOPCNTDQ-26]
_ = x[AVXIFMA-27]
_ = x[AVXNECONVERT-28]
_ = x[AVXSLOW-29]
_ = x[AVXVNNI-30]
_ = x[AVXVNNIINT8-31]
_ = x[BHI_CTRL-32]
_ = x[BMI1-33]
_ = x[BMI2-34]
_ = x[CETIBT-35]
_ = x[CETSS-36]
_ = x[CLDEMOTE-37]
_ = x[CLMUL-38]
_ = x[CLZERO-39]
_ = x[CMOV-40]
_ = x[CMPCCXADD-41]
_ = x[CMPSB_SCADBS_SHORT-42]
_ = x[CMPXCHG8-43]
_ = x[CPBOOST-44]
_ = x[CPPC-45]
_ = x[CX16-46]
_ = x[EFER_LMSLE_UNS-47]
_ = x[ENQCMD-48]
_ = x[ERMS-49]
_ = x[F16C-50]
_ = x[FLUSH_L1D-51]
_ = x[FMA3-52]
_ = x[FMA4-53]
_ = x[FP128-54]
_ = x[FP256-55]
_ = x[FSRM-56]
_ = x[FXSR-57]
_ = x[FXSROPT-58]
_ = x[GFNI-59]
_ = x[HLE-60]
_ = x[HRESET-61]
_ = x[HTT-62]
_ = x[HWA-63]
_ = x[HYBRID_CPU-64]
_ = x[HYPERVISOR-65]
_ = x[IA32_ARCH_CAP-66]
_ = x[IA32_CORE_CAP-67]
_ = x[IBPB-68]
_ = x[IBRS-69]
_ = x[IBRS_PREFERRED-70]
_ = x[IBRS_PROVIDES_SMP-71]
_ = x[IBS-72]
_ = x[IBSBRNTRGT-73]
_ = x[IBSFETCHSAM-74]
_ = x[IBSFFV-75]
_ = x[IBSOPCNT-76]
_ = x[IBSOPCNTEXT-77]
_ = x[IBSOPSAM-78]
_ = x[IBSRDWROPCNT-79]
_ = x[IBSRIPINVALIDCHK-80]
_ = x[IBS_FETCH_CTLX-81]
_ = x[IBS_OPDATA4-82]
_ = x[IBS_OPFUSE-83]
_ = x[IBS_PREVENTHOST-84]
_ = x[IBS_ZEN4-85]
_ = x[IDPRED_CTRL-86]
_ = x[INT_WBINVD-87]
_ = x[INVLPGB-88]
_ = x[LAHF-89]
_ = x[LAM-90]
_ = x[LBRVIRT-91]
_ = x[LZCNT-92]
_ = x[MCAOVERFLOW-93]
_ = x[MCDT_NO-94]
_ = x[MCOMMIT-95]
_ = x[MD_CLEAR-96]
_ = x[MMX-97]
_ = x[MMXEXT-98]
_ = x[MOVBE-99]
_ = x[MOVDIR64B-100]
_ = x[MOVDIRI-101]
_ = x[MOVSB_ZL-102]
_ = x[MOVU-103]
_ = x[MPX-104]
_ = x[MSRIRC-105]
_ = x[MSRLIST-106]
_ = x[MSR_PAGEFLUSH-107]
_ = x[NRIPS-108]
_ = x[NX-109]
_ = x[OSXSAVE-110]
_ = x[PCONFIG-111]
_ = x[POPCNT-112]
_ = x[PPIN-113]
_ = x[PREFETCHI-114]
_ = x[PSFD-115]
_ = x[RDPRU-116]
_ = x[RDRAND-117]
_ = x[RDSEED-118]
_ = x[RDTSCP-119]
_ = x[RRSBA_CTRL-120]
_ = x[RTM-121]
_ = x[RTM_ALWAYS_ABORT-122]
_ = x[SERIALIZE-123]
_ = x[SEV-124]
_ = x[SEV_64BIT-125]
_ = x[SEV_ALTERNATIVE-126]
_ = x[SEV_DEBUGSWAP-127]
_ = x[SEV_ES-128]
_ = x[SEV_RESTRICTED-129]
_ = x[SEV_SNP-130]
_ = x[SGX-131]
_ = x[SGXLC-132]
_ = x[SHA-133]
_ = x[SME-134]
_ = x[SME_COHERENT-135]
_ = x[SPEC_CTRL_SSBD-136]
_ = x[SRBDS_CTRL-137]
_ = x[SSE-138]
_ = x[SSE2-139]
_ = x[SSE3-140]
_ = x[SSE4-141]
_ = x[SSE42-142]
_ = x[SSE4A-143]
_ = x[SSSE3-144]
_ = x[STIBP-145]
_ = x[STIBP_ALWAYSON-146]
_ = x[STOSB_SHORT-147]
_ = x[SUCCOR-148]
_ = x[SVM-149]
_ = x[SVMDA-150]
_ = x[SVMFBASID-151]
_ = x[SVML-152]
_ = x[SVMNP-153]
_ = x[SVMPF-154]
_ = x[SVMPFT-155]
_ = x[SYSCALL-156]
_ = x[SYSEE-157]
_ = x[TBM-158]
_ = x[TDX_GUEST-159]
_ = x[TLB_FLUSH_NESTED-160]
_ = x[TME-161]
_ = x[TOPEXT-162]
_ = x[TSCRATEMSR-163]
_ = x[TSXLDTRK-164]
_ = x[VAES-165]
_ = x[VMCBCLEAN-166]
_ = x[VMPL-167]
_ = x[VMSA_REGPROT-168]
_ = x[VMX-169]
_ = x[VPCLMULQDQ-170]
_ = x[VTE-171]
_ = x[WAITPKG-172]
_ = x[WBNOINVD-173]
_ = x[WRMSRNS-174]
_ = x[X87-175]
_ = x[XGETBV1-176]
_ = x[XOP-177]
_ = x[XSAVE-178]
_ = x[XSAVEC-179]
_ = x[XSAVEOPT-180]
_ = x[XSAVES-181]
_ = x[AESARM-182]
_ = x[ARMCPUID-183]
_ = x[ASIMD-184]
_ = x[ASIMDDP-185]
_ = x[ASIMDHP-186]
_ = x[ASIMDRDM-187]
_ = x[ATOMICS-188]
_ = x[CRC32-189]
_ = x[DCPOP-190]
_ = x[EVTSTRM-191]
_ = x[FCMA-192]
_ = x[FP-193]
_ = x[FPHP-194]
_ = x[GPA-195]
_ = x[JSCVT-196]
_ = x[LRCPC-197]
_ = x[PMULL-198]
_ = x[SHA1-199]
_ = x[SHA2-200]
_ = x[SHA3-201]
_ = x[SHA512-202]
_ = x[SM3-203]
_ = x[SM4-204]
_ = x[SVE-205]
_ = x[lastID-206]
_ = x[firstID-0]
}
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWBMI1BMI2CLDEMOTECLMULCMOVCX16ENQCMDERMSF16CFMA3FMA4GFNIHLEHTTHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKLZCNTMMXMMXEXTMOVDIR64BMOVDIRIMPXNXPOPCNTRDRANDRDSEEDRDTSCPRTMSERIALIZESGXSGXLCSHASSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPTBMTSXLDTRKVAESVMXVPCLMULQDQWAITPKGWBNOINVDXOPAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 141, 151, 162, 170, 180, 198, 213, 220, 224, 228, 236, 241, 245, 249, 255, 259, 263, 267, 271, 275, 278, 281, 291, 295, 298, 308, 319, 325, 333, 344, 352, 364, 380, 385, 388, 394, 403, 410, 413, 415, 421, 427, 433, 439, 442, 451, 454, 459, 462, 465, 469, 473, 477, 482, 487, 492, 497, 500, 508, 512, 515, 525, 532, 540, 543, 549, 557, 562, 569, 576, 584, 591, 596, 601, 608, 612, 614, 618, 621, 626, 631, 636, 640, 644, 648, 654, 657, 660, 663, 669}
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {

View File

@@ -2,14 +2,120 @@
package cpuid
import "runtime"
import (
"runtime"
"strings"
"golang.org/x/sys/unix"
)
func detectOS(c *CPUInfo) bool {
if runtime.GOOS != "ios" {
tryToFillCPUInfoFomSysctl(c)
}
// There are no hw.optional sysctl values for the below features on Mac OS 11.0
// to detect their supported state dynamically. Assume the CPU features that
// Apple Silicon M1 supports to be available as a minimal set of features
// to all Go programs running on darwin/arm64.
// TODO: Add more if we know them.
c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2)
return true
}
func sysctlGetBool(name string) bool {
value, err := unix.SysctlUint32(name)
if err != nil {
return false
}
return value != 0
}
func sysctlGetString(name string) string {
value, err := unix.Sysctl(name)
if err != nil {
return ""
}
return value
}
func sysctlGetInt(unknown int, names ...string) int {
for _, name := range names {
value, err := unix.SysctlUint32(name)
if err != nil {
continue
}
if value != 0 {
return int(value)
}
}
return unknown
}
func sysctlGetInt64(unknown int, names ...string) int {
for _, name := range names {
value64, err := unix.SysctlUint64(name)
if err != nil {
continue
}
if int(value64) != unknown {
return int(value64)
}
}
return unknown
}
func setFeature(c *CPUInfo, name string, feature FeatureID) {
c.featureSet.setIf(sysctlGetBool(name), feature)
}
func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
c.BrandName = sysctlGetString("machdep.cpu.brand_string")
if len(c.BrandName) != 0 {
c.VendorString = strings.Fields(c.BrandName)[0]
}
c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu")
c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") /
sysctlGetInt(1, "hw.physicalcpu")
c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count")
c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily")
c.Model = sysctlGetInt(0, "machdep.cpu.model")
c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
// from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile
setFeature(c, "hw.optional.arm.FEAT_AES", AESARM)
setFeature(c, "hw.optional.AdvSIMD", ASIMD)
setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP)
setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM)
setFeature(c, "hw.optional.FEAT_CRC32", CRC32)
setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP)
// setFeature(c, "", EVTSTRM)
setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA)
setFeature(c, "hw.optional.arm.FEAT_FP", FP)
setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP)
setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA)
setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT)
setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC)
setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL)
setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1)
setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2)
setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3)
setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512)
// setFeature(c, "", SM3)
// setFeature(c, "", SM4)
setFeature(c, "hw.optional.arm.FEAT_SVE", SVE)
// from empirical observation
setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP)
setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS)
setFeature(c, "hw.optional.floatingpoint", FP)
setFeature(c, "hw.optional.armv8_2_sha3", SHA3)
setFeature(c, "hw.optional.armv8_2_sha512", SHA512)
setFeature(c, "hw.optional.armv8_3_compnum", FCMA)
setFeature(c, "hw.optional.armv8_crc32", CRC32)
}

View File

@@ -11,7 +11,6 @@ import (
"encoding/binary"
"io/ioutil"
"runtime"
"unsafe"
)
// HWCAP bits.
@@ -42,12 +41,9 @@ const (
hwcap_ASIMDFHM = 1 << 23
)
//go:linkname hwcap internal/cpu.HWCap
var hwcap uint
func detectOS(c *CPUInfo) bool {
// For now assuming no hyperthreading is reasonable.
c.LogicalCores = int(getproccount())
c.LogicalCores = runtime.NumCPU()
c.PhysicalCores = c.LogicalCores
c.ThreadsPerCore = 1
if hwcap == 0 {
@@ -132,30 +128,3 @@ func detectOS(c *CPUInfo) bool {
func isSet(hwc uint, value uint) bool {
return hwc&value != 0
}
//go:noescape
//go:linkname sched_getaffinity runtime.sched_getaffinity
func sched_getaffinity(pid, len uintptr, buf *byte) int32
func getproccount() int32 {
// This buffer is huge (8 kB) but we are on the system stack
// and there should be plenty of space (64 kB).
// Also this is a leaf, so we're not holding up the memory for long.
const maxCPUs = 64 * 1024
var buf [maxCPUs / 8]byte
r := sched_getaffinity(0, unsafe.Sizeof(buf), &buf[0])
if r < 0 {
return 0
}
n := int32(0)
for _, v := range buf[:r] {
for v != 0 {
n += int32(v & 1)
v >>= 1
}
}
if n == 0 {
n = 1
}
return n
}

View File

@@ -1,11 +1,16 @@
// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
// +build arm64
// +build !linux
// +build !darwin
//go:build arm64 && !linux && !darwin
// +build arm64,!linux,!darwin
package cpuid
import "runtime"
func detectOS(c *CPUInfo) bool {
c.PhysicalCores = runtime.NumCPU()
// For now assuming 1 thread per core...
c.ThreadsPerCore = 1
c.LogicalCores = c.PhysicalCores
return false
}

View File

@@ -0,0 +1,8 @@
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
//go:build nounsafe
// +build nounsafe
package cpuid
var hwcap uint

View File

@@ -0,0 +1,11 @@
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
//go:build !nounsafe
// +build !nounsafe
package cpuid
import _ "unsafe" // needed for go:linkname
//go:linkname hwcap internal/cpu.HWCap
var hwcap uint

View File

@@ -5,11 +5,11 @@ set -e
go tool dist list | while IFS=/ read os arch; do
echo "Checking $os/$arch..."
echo " normal"
GOARCH=$arch GOOS=$os go build -o /dev/null ./...
GOARCH=$arch GOOS=$os go build -o /dev/null .
echo " noasm"
GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null ./...
GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null .
echo " appengine"
GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null ./...
GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null .
echo " noasm,appengine"
GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null ./...
GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null .
done

View File

@@ -23,6 +23,11 @@ import (
"github.com/klauspost/cpuid/v2"
)
var (
hasIntelSha = runtime.GOARCH == "amd64" && cpuid.CPU.Supports(cpuid.SHA, cpuid.SSSE3, cpuid.SSE4)
hasAvx512 = cpuid.CPU.Supports(cpuid.AVX512F, cpuid.AVX512DQ, cpuid.AVX512BW, cpuid.AVX512VL)
)
func hasArmSha2() bool {
if cpuid.CPU.Has(cpuid.SHA2) {
return true
@@ -42,5 +47,4 @@ func hasArmSha2() bool {
return false
}
return bytes.Contains(cpuInfo, []byte(sha256Feature))
}

View File

@@ -19,10 +19,8 @@ package sha256
import (
"crypto/sha256"
"encoding/binary"
"errors"
"hash"
"runtime"
"github.com/klauspost/cpuid/v2"
)
// Size - The size of a SHA256 checksum in bytes.
@@ -68,42 +66,34 @@ func (d *digest) Reset() {
type blockfuncType int
const (
blockfuncGeneric blockfuncType = iota
blockfuncSha blockfuncType = iota
blockfuncArm blockfuncType = iota
blockfuncStdlib blockfuncType = iota
blockfuncIntelSha
blockfuncArmSha2
blockfuncForceGeneric = -1
)
var blockfunc blockfuncType
func init() {
blockfunc = blockfuncGeneric
switch {
case hasSHAExtensions():
blockfunc = blockfuncSha
case hasIntelSha:
blockfunc = blockfuncIntelSha
case hasArmSha2():
blockfunc = blockfuncArm
default:
blockfunc = blockfuncGeneric
blockfunc = blockfuncArmSha2
}
}
var avx512 = cpuid.CPU.Supports(cpuid.AVX512F, cpuid.AVX512DQ, cpuid.AVX512BW, cpuid.AVX512VL)
// hasSHAExtensions return whether the cpu supports SHA extensions.
func hasSHAExtensions() bool {
return cpuid.CPU.Supports(cpuid.SHA, cpuid.SSSE3, cpuid.SSE4) && runtime.GOARCH == "amd64"
}
// New returns a new hash.Hash computing the SHA256 checksum.
func New() hash.Hash {
if blockfunc != blockfuncGeneric {
d := new(digest)
d.Reset()
return d
}
if blockfunc == blockfuncStdlib {
// Fallback to the standard golang implementation
// if no features were found.
return sha256.New()
}
d := new(digest)
d.Reset()
return d
}
// Sum256 - single caller sha256 helper
@@ -272,11 +262,11 @@ func (d *digest) checkSum() (digest [Size]byte) {
}
func block(dig *digest, p []byte) {
if blockfunc == blockfuncSha {
blockShaGo(dig, p)
} else if blockfunc == blockfuncArm {
blockArmGo(dig, p)
} else if blockfunc == blockfuncGeneric {
if blockfunc == blockfuncIntelSha {
blockIntelShaGo(dig, p)
} else if blockfunc == blockfuncArmSha2 {
blockArmSha2Go(dig, p)
} else {
blockGeneric(dig, p)
}
}
@@ -397,3 +387,82 @@ var _K = []uint32{
0xbef9a3f7,
0xc67178f2,
}
const (
magic256 = "sha\x03"
marshaledSize = len(magic256) + 8*4 + chunk + 8
)
func (d *digest) MarshalBinary() ([]byte, error) {
b := make([]byte, 0, marshaledSize)
b = append(b, magic256...)
b = appendUint32(b, d.h[0])
b = appendUint32(b, d.h[1])
b = appendUint32(b, d.h[2])
b = appendUint32(b, d.h[3])
b = appendUint32(b, d.h[4])
b = appendUint32(b, d.h[5])
b = appendUint32(b, d.h[6])
b = appendUint32(b, d.h[7])
b = append(b, d.x[:d.nx]...)
b = b[:len(b)+len(d.x)-d.nx] // already zero
b = appendUint64(b, d.len)
return b, nil
}
func (d *digest) UnmarshalBinary(b []byte) error {
if len(b) < len(magic256) || string(b[:len(magic256)]) != magic256 {
return errors.New("crypto/sha256: invalid hash state identifier")
}
if len(b) != marshaledSize {
return errors.New("crypto/sha256: invalid hash state size")
}
b = b[len(magic256):]
b, d.h[0] = consumeUint32(b)
b, d.h[1] = consumeUint32(b)
b, d.h[2] = consumeUint32(b)
b, d.h[3] = consumeUint32(b)
b, d.h[4] = consumeUint32(b)
b, d.h[5] = consumeUint32(b)
b, d.h[6] = consumeUint32(b)
b, d.h[7] = consumeUint32(b)
b = b[copy(d.x[:], b):]
b, d.len = consumeUint64(b)
d.nx = int(d.len % chunk)
return nil
}
func appendUint32(b []byte, v uint32) []byte {
return append(b,
byte(v>>24),
byte(v>>16),
byte(v>>8),
byte(v),
)
}
func appendUint64(b []byte, v uint64) []byte {
return append(b,
byte(v>>56),
byte(v>>48),
byte(v>>40),
byte(v>>32),
byte(v>>24),
byte(v>>16),
byte(v>>8),
byte(v),
)
}
func consumeUint64(b []byte) ([]byte, uint64) {
_ = b[7]
x := uint64(b[7]) | uint64(b[6])<<8 | uint64(b[5])<<16 | uint64(b[4])<<24 |
uint64(b[3])<<32 | uint64(b[2])<<40 | uint64(b[1])<<48 | uint64(b[0])<<56
return b[8:], x
}
func consumeUint32(b []byte) ([]byte, uint32) {
_ = b[3]
x := uint32(b[3]) | uint32(b[2])<<8 | uint32(b[1])<<16 | uint32(b[0])<<24
return b[4:], x
}

View File

@@ -1,4 +1,5 @@
//+build !noasm,!appengine,gc
//go:build !noasm && !appengine && gc
// +build !noasm,!appengine,gc
/*
* Minio Cloud Storage, (C) 2017 Minio, Inc.

View File

@@ -1,4 +1,4 @@
//+build !noasm,!appengine
//+build !noasm,!appengine,gc
TEXT ·sha256X16Avx512(SB), 7, $0
MOVQ digests+0(FP), DI

View File

@@ -1,6 +0,0 @@
//+build !noasm,!appengine,gc
package sha256
//go:noescape
func blockSha(h *[8]uint32, message []uint8)

View File

@@ -1,4 +1,5 @@
//+build !noasm,!appengine,gc
//go:build !noasm && !appengine && gc
// +build !noasm,!appengine,gc
/*
* Minio Cloud Storage, (C) 2016 Minio, Inc.
@@ -18,10 +19,13 @@
package sha256
func blockArmGo(dig *digest, p []byte) {
panic("blockArmGo called unexpectedly")
func blockArmSha2Go(dig *digest, p []byte) {
panic("blockArmSha2Go called unexpectedly")
}
func blockShaGo(dig *digest, p []byte) {
blockSha(&dig.h, p)
//go:noescape
func blockIntelSha(h *[8]uint32, message []uint8)
func blockIntelShaGo(dig *digest, p []byte) {
blockIntelSha(&dig.h, p)
}

View File

@@ -1,4 +1,4 @@
//+build !noasm,!appengine
//+build !noasm,!appengine,gc
// SHA intrinsic version of SHA256
@@ -106,7 +106,7 @@ GLOBL SHUF_MASK<>(SB), RODATA|NOPTR, $16
// X13 saved hash state // CDGH
// X15 data shuffle mask (constant)
TEXT ·blockSha(SB), NOSPLIT, $0-32
TEXT ·blockIntelSha(SB), NOSPLIT, $0-32
MOVQ h+0(FP), DX
MOVQ message_base+8(FP), SI
MOVQ message_len+16(FP), DI

View File

@@ -1,4 +1,5 @@
//+build !noasm,!appengine,gc
//go:build !noasm && !appengine && gc
// +build !noasm,!appengine,gc
/*
* Minio Cloud Storage, (C) 2016 Minio, Inc.
@@ -18,18 +19,18 @@
package sha256
func blockShaGo(dig *digest, p []byte) {
panic("blockShaGoc called unexpectedly")
func blockIntelShaGo(dig *digest, p []byte) {
panic("blockIntelShaGo called unexpectedly")
}
//go:noescape
func blockArm(h []uint32, message []uint8)
func blockArmSha2(h []uint32, message []uint8)
func blockArmGo(dig *digest, p []byte) {
func blockArmSha2Go(dig *digest, p []byte) {
h := []uint32{dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7]}
blockArm(h[:], p[:])
blockArmSha2(h[:], p[:])
dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7] = h[0], h[1], h[2], h[3], h[4],
h[5], h[6], h[7]

View File

@@ -1,4 +1,4 @@
//+build !noasm,!appengine
//+build !noasm,!appengine,gc
// ARM64 version of SHA256
@@ -25,7 +25,7 @@
// their Plan9 equivalents
//
TEXT ·blockArm(SB), 7, $0
TEXT ·blockArmSha2(SB), 7, $0
MOVD h+0(FP), R0
MOVD message+24(FP), R1
MOVD message_len+32(FP), R2 // length of message

View File

@@ -1,4 +1,5 @@
//+build appengine noasm !amd64,!arm64 !gc
//go:build appengine || noasm || (!amd64 && !arm64) || !gc
// +build appengine noasm !amd64,!arm64 !gc
/*
* Minio Cloud Storage, (C) 2019 Minio, Inc.
@@ -18,11 +19,11 @@
package sha256
func blockShaGo(dig *digest, p []byte) {
panic("blockShaGo called unexpectedly")
func blockIntelShaGo(dig *digest, p []byte) {
panic("blockIntelShaGo called unexpectedly")
}
func blockArmGo(dig *digest, p []byte) {
panic("blockArmGo called unexpectedly")
func blockArmSha2Go(dig *digest, p []byte) {
panic("blockArmSha2Go called unexpectedly")
}

8
vendor/modules.txt vendored
View File

@@ -299,8 +299,8 @@ github.com/klauspost/compress/internal/cpuinfo
github.com/klauspost/compress/internal/snapref
github.com/klauspost/compress/zstd
github.com/klauspost/compress/zstd/internal/xxhash
# github.com/klauspost/cpuid/v2 v2.0.4
## explicit; go 1.13
# github.com/klauspost/cpuid/v2 v2.2.5
## explicit; go 1.15
github.com/klauspost/cpuid/v2
# github.com/matttproud/golang_protobuf_extensions v1.0.4
## explicit; go 1.9
@@ -308,8 +308,8 @@ github.com/matttproud/golang_protobuf_extensions/pbutil
# github.com/miekg/pkcs11 v1.1.1
## explicit; go 1.12
github.com/miekg/pkcs11
# github.com/minio/sha256-simd v1.0.0
## explicit; go 1.13
# github.com/minio/sha256-simd v1.0.1
## explicit; go 1.17
github.com/minio/sha256-simd
# github.com/mistifyio/go-zfs/v3 v3.0.1
## explicit; go 1.14